eF-site ID 6d0u-J
PDB Code 6d0u
Chain J

click to enlarge
Title Crystal structure of C05 V110P/A117E mutant bound to H3 influenza hemagglutinin, HA1 subunit
Classification ANTIVIRAL PROTEIN
Compound Hemagglutinin
Source (6D0U)
Sequence J:  VQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNE
TWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFIT
EGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYP
VLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRV
TVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDV
LVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECI
TPNGSIPNDKPFQNVNKITYGACPKYV
Description (1)  Hemagglutinin, Antibody C05 V110P/A117E mutant, heavy chain, Antibody C05, light chain


Functional site

1) chain J
residue 165
type
ligand
sequence N
description binding site for Mono-Saccharide NAG J 401 bound to ASN J 165
source : AC2

2) chain J
residue 165
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d0u_J_401

3) chain J
residue 167
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d0u_J_401


Display surface

Download
Links