eF-site ID 6d0u-ABCDEFGHIJKL
PDB Code 6d0u
Chain A, B, C, D, E, F, G, H, I, J, K, L

click to enlarge
Title Crystal structure of C05 V110P/A117E mutant bound to H3 influenza hemagglutinin, HA1 subunit
Classification ANTIVIRAL PROTEIN
Compound Hemagglutinin
Source (6D0U)
Sequence A:  VQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNE
TWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFIT
EGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYP
VLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRV
TVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDV
LVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECI
TPNGSIPNDKPFQNVNKITYGACPKYV
B:  VQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNE
TWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFIT
EGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYP
VLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRV
TVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDV
LVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECI
TPNGSIPNDKPFQNVNKITYGACPKYV
C:  VQLQESGGGLVQPGESLRLSCVGSGSSFGESTLSYYAVSW
VRQAPGKGLEWLSIINAGGGDIDYADSVEGRFTISRDNSK
ETLYLQMTNLRVEDTGVYYCAKHMSMQQVPSAGWEREDLV
GDAFDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
D:  DIQLTQSPSSLSASVGDRVTLTCQASQDIRKFLNWYQQKP
GKGPKLLIYDASNLQRGVPSRFSGGGSGTDFTLIISSLQP
EDVGTYYCQQYDGLPFTFGGGTKVVIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGE
E:  VQLQESGGGLVQPGESLRLSCVGSGSSFGESTLSYYAVSW
VRQAPGKGLEWLSIINAGGGDIDYADSVEGRFTISRDNSK
ETLYLQMTNLRVEDTGVYYCAKHMSMQQVPSAGWEREDLV
GDAFDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
F:  DIQLTQSPSSLSASVGDRVTLTCQASQDIRKFLNWYQQKP
GKGPKLLIYDASNLQRGVPSRFSGGGSGTDFTLIISSLQP
EDVGTYYCQQYDGLPFTFGGGTKVVIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGE
G:  VQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNE
TWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFIT
EGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYP
VLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRV
TVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDV
LVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECI
TPNGSIPNDKPFQNVNKITYGACPKYV
H:  VQLQESGGGLVQPGESLRLSCVGSGSSFGESTLSYYAVSW
VRQAPGKGLEWLSIINAGGGDIDYADSVEGRFTISRDNSK
ETLYLQMTNLRVEDTGVYYCAKHMSMQQVPSAGWEREDLV
GDAFDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
I:  DIQLTQSPSSLSASVGDRVTLTCQASQDIRKFLNWYQQKP
GKGPKLLIYDASNLQRGVPSRFSGGGSGTDFTLIISSLQP
EDVGTYYCQQYDGLPFTFGGGTKVVIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGE
J:  VQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNE
TWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFIT
EGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYP
VLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRV
TVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDV
LVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECI
TPNGSIPNDKPFQNVNKITYGACPKYV
K:  VQLQESGGGLVQPGESLRLSCVGSGSSFGESTLSYYAVSW
VRQAPGKGLEWLSIINAGGGDIDYADSVEGRFTISRDNSK
ETLYLQMTNLRVEDTGVYYCAKHMSMQQVPSAGWEREDLV
GDAFDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
L:  DIQLTQSPSSLSASVGDRVTLTCQASQDIRKFLNWYQQKP
GKGPKLLIYDASNLQRGVPSRFSGGGSGTDFTLIISSLQP
EDVGTYYCQQYDGLPFTFGGGTKVVIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGE
Description (1)  Hemagglutinin, Antibody C05 V110P/A117E mutant, heavy chain, Antibody C05, light chain


Functional site

1) chain G
residue 285
type
ligand
sequence N
description binding site for residue NAG G 401
source : AC1

2) chain G
residue 297
type
ligand
sequence V
description binding site for residue NAG G 401
source : AC1

3) chain G
residue 298
type
ligand
sequence N
description binding site for residue NAG G 401
source : AC1

4) chain J
residue 165
type
ligand
sequence N
description binding site for Mono-Saccharide NAG J 401 bound to ASN J 165
source : AC2

5) chain J
residue 165
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d0u_J_401

6) chain J
residue 167
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d0u_J_401

7) chain G
residue 45
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence S
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d0u_G_401

8) chain G
residue 285
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d0u_G_401

9) chain G
residue 296-298
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NVN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_6d0u_G_401


Display surface

Download
Links