eF-site ID 6d0u-A
PDB Code 6d0u
Chain A

click to enlarge
Title Crystal structure of C05 V110P/A117E mutant bound to H3 influenza hemagglutinin, HA1 subunit
Classification ANTIVIRAL PROTEIN
Compound Hemagglutinin
Source (6D0U)
Sequence A:  VQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNE
TWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFIT
EGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYP
VLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRV
TVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDV
LVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECI
TPNGSIPNDKPFQNVNKITYGACPKYV
Description (1)  Hemagglutinin, Antibody C05 V110P/A117E mutant, heavy chain, Antibody C05, light chain

Display surface

Download
Links