eF-site ID 6d0f-A PDB Code 6d0f Chain A click to enlarge Title Estrogen Receptor Alpha Ligand Binding Domain Y537S Mutant in Complex with 3OHTPE and GRIP Peptide Classification NUCLEAR PROTEIN Compound Estrogen receptor Source (6D0F) Sequence A:  LTADQMVSALLDAEPPILYSEASMMGLLTNLADRELVHMI NWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEH PGKLLFAPNLLLDRNQGMVEIFDMLLATSSRFRMMNLQGE EFVCLKSIILLNSGVYTLEEKDHIHRVLDKITDTLIHLMA KAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKSD LLLEMLDAH Description Functional site 1) chain A residue 346 type sequence L description binding site for residue FYS A 601 source : AC1 2) chain A residue 347 type sequence T description binding site for residue FYS A 601 source : AC1 3) chain A residue 353 type sequence E description binding site for residue FYS A 601 source : AC1 4) chain A residue 387 type sequence L description binding site for residue FYS A 601 source : AC1 5) chain A residue 391 type sequence L description binding site for residue FYS A 601 source : AC1 6) chain A residue 394 type sequence R description binding site for residue FYS A 601 source : AC1 7) chain A residue 404 type sequence F description binding site for residue FYS A 601 source : AC1 8) chain A residue 428 type sequence L description binding site for residue FYS A 601 source : AC1 9) chain A residue 521 type sequence G description binding site for residue FYS A 601 source : AC1 10) chain A residue 524 type sequence H description binding site for residue FYS A 601 source : AC1 11) chain A residue 525 type sequence L description binding site for residue FYS A 601 source : AC1 12) chain A residue 540 type sequence L description binding site for residue FYS A 601 source : AC1 13) chain A residue 537 type MOD_RES sequence S description Phosphotyrosine; by Tyr-kinases => ECO:0000269|PubMed:7539106 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 447 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links