eF-site ID 6cul-H PDB Code 6cul Chain H click to enlarge Title PvdF of pyoverdin biosynthesis is a structurally unique N10-formyltetrahydrofolate-dependent formyltransferase Classification TRANSFERASE Compound Pyoverdine synthetase F Source (Q9I184_PSEAE) Sequence H:  TKRKLAYIWSLRNAAADKAGQYVPYKYXKSVLESLVEALN QTALGDAYELVGVIYDDDAELPRDQGKIKDYGFAYRPGQQ WFYPADLQVQGKTLNDLLLSVPSTYRRYPRGTPEHVAGKS DFERRLHDTLVELGADVVVLDGLLVILDELVRPGAPFARR IXNIHPGVTREDSPYERRGAYATLDALYGARGEKVVDWAT XEKVAVEPLYWTGASFHYVDDSGEVFHDVLKTEISPDDTI LELRWNNFNNSLFPALHEGLALLAEKL Description (1)  Pyoverdine synthetase F Functional site 1) chain H residue 109 type sequence T description binding site for residue FGD E 301 source : AC8 2) chain H residue 112 type sequence R description binding site for residue FGD E 301 source : AC8 3) chain H residue 113 type sequence Y description binding site for residue FGD E 301 source : AC8 4) chain H residue 114 type sequence P description binding site for residue FGD E 301 source : AC8 5) chain H residue 67 type sequence P description binding site for residue FGD H 301 source : AD5 6) chain H residue 68 type sequence R description binding site for residue FGD H 301 source : AD5 7) chain H residue 71 type sequence G description binding site for residue FGD H 301 source : AD5 8) chain H residue 72 type sequence K description binding site for residue FGD H 301 source : AD5 9) chain H residue 75 type sequence D description binding site for residue FGD H 301 source : AD5 10) chain H residue 13 type sequence R description binding site for residue CIT H 302 source : AD6 11) chain H residue 68 type sequence R description binding site for residue CIT H 302 source : AD6 12) chain H residue 72 type sequence K description binding site for residue CIT H 302 source : AD6 13) chain H residue 111 type sequence R description binding site for residue CIT H 302 source : AD6

Display surface Download Links