eF-site ID 6cul-G PDB Code 6cul Chain G click to enlarge Title PvdF of pyoverdin biosynthesis is a structurally unique N10-formyltetrahydrofolate-dependent formyltransferase Classification TRANSFERASE Compound Pyoverdine synthetase F Source (Q9I184_PSEAE) Sequence G:  KRKLAYIWSLRNAAADKAGQYVPYKGEQRYXKSVLESLVE ALNQTALGDAYELVGVIYDDDAELPRDQGKIKDYGFAYQQ WFYPADLQVQGKTLNDLLLSVPSTYRRYPRGTPEHVAGKS DFERRLHDTLVELGADVVVLDGLLVILDELVRPGAPFARR IXNIHPGVTREDSPYERRGAYATLDALYGARGEKVVDWAT XEKVAVEPLYWTGASFHYVDSGEVFHDVLKTEISPDDTIL ELRWNNFNNSLFPALHEGLALLAEK Description (1)  Pyoverdine synthetase F Functional site 1) chain G residue 68 type sequence R description binding site for residue FGD G 301 source : AD3 2) chain G residue 71 type sequence G description binding site for residue FGD G 301 source : AD3 3) chain G residue 72 type sequence K description binding site for residue FGD G 301 source : AD3 4) chain G residue 75 type sequence D description binding site for residue FGD G 301 source : AD3 5) chain G residue 13 type sequence R description binding site for residue CIT G 302 source : AD4 6) chain G residue 68 type sequence R description binding site for residue CIT G 302 source : AD4 7) chain G residue 72 type sequence K description binding site for residue CIT G 302 source : AD4 8) chain G residue 111 type sequence R description binding site for residue CIT G 302 source : AD4 9) chain G residue 109 type sequence T description binding site for residue FGD H 301 source : AD5 10) chain G residue 112 type sequence R description binding site for residue FGD H 301 source : AD5 11) chain G residue 113 type sequence Y description binding site for residue FGD H 301 source : AD5

Display surface Download Links