eF-site ID 6cul-F PDB Code 6cul Chain F click to enlarge Title PvdF of pyoverdin biosynthesis is a structurally unique N10-formyltetrahydrofolate-dependent formyltransferase Classification TRANSFERASE Compound Pyoverdine synthetase F Source (Q9I184_PSEAE) Sequence F:  KRKLAYIWSLRNAAADKAGQYVPYQRYXKSVLESLVEALN QTALGDAYELVGVIYDDDAELPRDQGKIKDYGFAYQWFYP ADLQVQGKTLNDLLLSVPSTYRRYPRGTPEHVAGKSDFER RLHDTLVELGADVVVLDGLLVILDELVRPGAPFARRIXNI HPGVTREDSPYERRGAYATLDALYGARGEKVVDWATXEKV AVEPLYWTGASFHYVGEVFHDVLKTEISPDDTILELRWNN FNNSLFPALHEGLALLA Description (1)  Pyoverdine synthetase F Functional site 1) chain F residue 68 type sequence R description binding site for residue FGD F 301 source : AD1 2) chain F residue 71 type sequence G description binding site for residue FGD F 301 source : AD1 3) chain F residue 72 type sequence K description binding site for residue FGD F 301 source : AD1 4) chain F residue 75 type sequence D description binding site for residue FGD F 301 source : AD1 5) chain F residue 13 type sequence R description binding site for residue CIT F 302 source : AD2 6) chain F residue 68 type sequence R description binding site for residue CIT F 302 source : AD2 7) chain F residue 72 type sequence K description binding site for residue CIT F 302 source : AD2 8) chain F residue 111 type sequence R description binding site for residue CIT F 302 source : AD2 9) chain F residue 109 type sequence T description binding site for residue FGD G 301 source : AD3 10) chain F residue 112 type sequence R description binding site for residue FGD G 301 source : AD3 11) chain F residue 113 type sequence Y description binding site for residue FGD G 301 source : AD3

Display surface Download Links