eF-site ID 6cmo-R
PDB Code 6cmo
Chain R

click to enlarge
Title Rhodopsin-Gi complex
Classification SIGNALING PROTEIN
Compound chimera protein of Soluble cytochrome b562 and Rhodopsin
Source (6CMO)
Sequence R:  MCGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSML
AAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLA
VADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLQGFFATLG
GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFT
WVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNN
ESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQES
ATTQKAEKEVTRMVIIYVIAFLICWVPYASVAFYIFTHQG
SCFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTT
ICC
Description (1)  Soluble cytochrome b562,Rhodopsin, Guanine nucleotide-binding protein G(i) subunit alpha-1, Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2, Fab light chain, Fab Heavy chain


Functional site

1) chain R
residue 4
type
ligand
sequence T
description binding site for Poly-Saccharide residues NAG R 501 through NAG R 502 bound to ASN R 15
source : AC1

2) chain R
residue 15
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG R 501 through NAG R 502 bound to ASN R 15
source : AC1

3) chain R
residue 18
type
ligand
sequence G
description binding site for Poly-Saccharide residues NAG R 501 through NAG R 502 bound to ASN R 15
source : AC1

4) chain R
residue 20
type
ligand
sequence V
description binding site for Poly-Saccharide residues NAG R 501 through NAG R 502 bound to ASN R 15
source : AC1

5) chain R
residue 21
type
ligand
sequence R
description binding site for Poly-Saccharide residues NAG R 501 through NAG R 502 bound to ASN R 15
source : AC1

6) chain R
residue 123-139
type prosite
ligand
sequence IALWSLVVLAIERYVVV
description G-protein coupled receptors family 1 signature.[GSTALIVMFYWC]-[GSTANCPDE]-{EDPKRH}-x-{PQ}-[LIVMNQGA]-{RK}-{RK}-[LIVMFT]-[GSTANC]-[LIVMFYWSTAC]-[DENH]-R-[FYWCSH]-{PE}-x-[LIVM].
source prosite : PS00237

7) chain R
residue 290-306
type prosite
ligand
sequence IPAFFAKSAAIYNPVIY
description Visual pigments (opsins) retinal binding site.[LIVMFWAC]-[PSGAC]-x-{G}-x-[SAC]-K-[STALIMR]-[GSACPNV]-[STACP]-x(2)-[DENF]-[AP]-x(2)-[IY].
source prosite : PS00238


Display surface

Download
Links