eF-site ID 6cmo-A
PDB Code 6cmo
Chain A

click to enlarge
Title Rhodopsin-Gi complex
Classification SIGNALING PROTEIN
Compound chimera protein of Soluble cytochrome b562 and Rhodopsin
Source (6CMO)
Sequence A:  MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG
AGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQS
IIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLD
RIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFD
VGAQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKK
SPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIY
THFTCSTDTKNVQFVFDAVTDVIIKNNLKDCGLF
Description (1)  Soluble cytochrome b562,Rhodopsin, Guanine nucleotide-binding protein G(i) subunit alpha-1, Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2, Fab light chain, Fab Heavy chain

Display surface

Download
Links