eF-site ID 6cmo-R PDB Code 6cmo Chain R click to enlarge Title Rhodopsin-Gi complex Classification SIGNALING PROTEIN Compound chimera protein of Soluble cytochrome b562 and Rhodopsin Source (6CMO) Sequence R:  MCGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSML AAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLA VADLFMVLGGFTSTLYTSLHGYFVFGPTGCNLQGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFT WVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNN ESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIYVIAFLICWVPYASVAFYIFTHQG SCFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTT ICC Description (1)  Soluble cytochrome b562,Rhodopsin, Guanine nucleotide-binding protein G(i) subunit alpha-1, Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2, Fab light chain, Fab Heavy chain Functional site 1) chain R residue 279 type LIPID sequence Q description S-palmitoyl cysteine => ECO:0000250|UniProtKB:P10824 source Swiss-Prot : SWS_FT_FI11 2) chain R residue 113 type SITE sequence Q description Plays an important role in the conformation switch to the active conformation => ECO:0000269|PubMed:26200343 source Swiss-Prot : SWS_FT_FI12 3) chain R residue 296 type MOD_RES sequence K description N6-(retinylidene)lysine => ECO:0000250|UniProtKB:P02699 source Swiss-Prot : SWS_FT_FI13 4) chain R residue 322 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000250|UniProtKB:P02699 source Swiss-Prot : SWS_FT_FI14 5) chain R residue 323 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000250|UniProtKB:P02699 source Swiss-Prot : SWS_FT_FI14 6) chain R residue 15 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000269|PubMed:28753425 source Swiss-Prot : SWS_FT_FI15 7) chain R residue 134-152 type LIPID sequence ERYVVVCKPMSNFRFGENH description S-geranylgeranyl cysteine => ECO:0000269|PubMed:12764189, ECO:0000269|PubMed:1903391, ECO:0000269|PubMed:7626050 source Swiss-Prot : SWS_FT_FI3 8) chain R residue 225-252 type LIPID sequence QLVFTVKEAAAQQQESATTQKAEKEVTR description S-geranylgeranyl cysteine => ECO:0000269|PubMed:12764189, ECO:0000269|PubMed:1903391, ECO:0000269|PubMed:7626050 source Swiss-Prot : SWS_FT_FI3 9) chain R residue 174-202 type BINDING sequence GWSRYIPEGLQCSCGIDYYTLKPEVNNES description BINDING => ECO:0000269|PubMed:21115486 source Swiss-Prot : SWS_FT_FI5 10) chain R residue 275-284 type BINDING sequence IFTHQGSCFG description BINDING => ECO:0000269|PubMed:21115486 source Swiss-Prot : SWS_FT_FI5 11) chain R residue 123-139 type prosite sequence IALWSLVVLAIERYVVV description G_PROTEIN_RECEP_F1_1 G-protein coupled receptors family 1 signature. IALwSLVVLAIERYVvV source prosite : PS00237 12) chain R residue 290-306 type prosite sequence IPAFFAKSAAIYNPVIY description OPSIN Visual pigments (opsins) retinal binding site. IPaFfAKSAAiyNPviY source prosite : PS00238

Display surface Download Links