eF-site ID 6cm2-D PDB Code 6cm2 Chain D click to enlarge Title SAMHD1 HD domain bound to decitabine triphosphate Classification HYDROLASE Compound Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 Source (SAMH1_HUMAN) Sequence D:  DTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGG GYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQIS ERDVLCVQIAGLCRNLGHGPFSHMFDGRFIPLARPEVKWT HEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFIKEQI VGPLELWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFAR DCHHLGIQNNFDYKRFIKFARVCEVDNELRICARDKEVGN LYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIE ITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKL KDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPK EVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHV SFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVD RKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEW N Description Functional site 1) chain D residue 149 type sequence Q description binding site for residue F6G D 701 source : AC1 2) chain D residue 150 type sequence L description binding site for residue F6G D 701 source : AC1 3) chain D residue 164 type sequence R description binding site for residue F6G D 701 source : AC1 4) chain D residue 206 type sequence R description binding site for residue F6G D 701 source : AC1 5) chain D residue 215 type sequence H description binding site for residue F6G D 701 source : AC1 6) chain D residue 233 type sequence H description binding site for residue F6G D 701 source : AC1 7) chain D residue 312 type sequence K description binding site for residue F6G D 701 source : AC1 8) chain D residue 315 type sequence Y description binding site for residue F6G D 701 source : AC1 9) chain D residue 319 type sequence D description binding site for residue F6G D 701 source : AC1 10) chain D residue 366 type sequence R description binding site for residue F6G D 701 source : AC1 11) chain D residue 370 type sequence H description binding site for residue F6G D 701 source : AC1 12) chain D residue 374 type sequence Y description binding site for residue F6G D 701 source : AC1 13) chain D residue 375 type sequence Q description binding site for residue F6G D 701 source : AC1 14) chain D residue 155 type sequence Y description binding site for residue GTP D 702 source : AC2 15) chain D residue 156 type sequence V description binding site for residue GTP D 702 source : AC2 16) chain D residue 451 type sequence R description binding site for residue GTP D 702 source : AC2 17) chain D residue 455 type sequence K description binding site for residue GTP D 702 source : AC2 18) chain D residue 333 type sequence R description binding site for residue F6G D 703 source : AC3 19) chain D residue 337 type sequence F description binding site for residue F6G D 703 source : AC3 20) chain D residue 352 type sequence R description binding site for residue F6G D 703 source : AC3 21) chain D residue 354 type sequence K description binding site for residue F6G D 703 source : AC3 22) chain D residue 523 type sequence K description binding site for residue F6G D 703 source : AC3 23) chain D residue 117 type sequence V description binding site for residue F6G C 703 source : AC6 24) chain D residue 119 type sequence N description binding site for residue F6G C 703 source : AC6 25) chain D residue 116 type sequence K description binding site for residue MG C 704 source : AC7 26) chain D residue 156 type sequence V description binding site for residue F6G B 701 source : AC8 27) chain D residue 157 type sequence F description binding site for residue F6G B 701 source : AC8 28) chain D residue 372 type sequence R description binding site for residue F6G B 701 source : AC8 29) chain D residue 376 type sequence H description binding site for residue F6G B 701 source : AC8 30) chain D residue 377 type sequence K description binding site for residue F6G B 701 source : AC8 31) chain D residue 378 type sequence V description binding site for residue F6G B 701 source : AC8 32) chain D residue 523 type sequence K description binding site for residue GTP B 705 source : AD3 33) chain D residue 116 type sequence K description binding site for residue GTP A 704 source : AD7 34) chain D residue 117 type sequence V description binding site for residue GTP A 704 source : AD7 35) chain D residue 118 type sequence I description binding site for residue GTP A 704 source : AD7 36) chain D residue 137 type sequence D description binding site for residue GTP A 704 source : AD7 37) chain D residue 142 type sequence Q description binding site for residue GTP A 704 source : AD7 38) chain D residue 145 type sequence R description binding site for residue GTP A 704 source : AD7 39) chain D residue 165 type sequence F description binding site for residue GTP A 704 source : AD7 40) chain D residue 592 type MOD_RES sequence T description Phosphothreonine; by CDK1 => ECO:0000269|PubMed:23601106, ECO:0000269|PubMed:23602554, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200, ECO:0000269|PubMed:29610582, ECO:0000269|PubMed:29670289, ECO:0007744|PubMed:17081983, ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:18691976, ECO:0007744|PubMed:19369195, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI6 41) chain D residue 233 type ACT_SITE sequence H description ACT_SITE => ECO:0000305|PubMed:22056990 source Swiss-Prot : SWS_FT_FI1 42) chain D residue 116 type BINDING sequence K description in other chain => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI2 43) chain D residue 137 type BINDING sequence D description in other chain => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI2 44) chain D residue 333 type BINDING sequence R description in other chain => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI2 45) chain D residue 352 type BINDING sequence R description in other chain => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI2 46) chain D residue 358 type BINDING sequence N description in other chain => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI2 47) chain D residue 523 type BINDING sequence K description in other chain => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI2 48) chain D residue 119 type BINDING sequence N description BINDING => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI3 49) chain D residue 376 type BINDING sequence H description BINDING => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI3 50) chain D residue 377 type BINDING sequence K description BINDING => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI3 51) chain D residue 451 type BINDING sequence R description BINDING => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI3 52) chain D residue 455 type BINDING sequence K description BINDING => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25267621, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26294762, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI3 53) chain D residue 149 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:24141705 source Swiss-Prot : SWS_FT_FI4 54) chain D residue 164 type BINDING sequence R description BINDING => ECO:0000269|PubMed:24141705 source Swiss-Prot : SWS_FT_FI4 55) chain D residue 210 type BINDING sequence H description BINDING => ECO:0000269|PubMed:24141705 source Swiss-Prot : SWS_FT_FI4 56) chain D residue 309 type BINDING sequence D description BINDING => ECO:0000269|PubMed:24141705 source Swiss-Prot : SWS_FT_FI4 57) chain D residue 315 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:24141705 source Swiss-Prot : SWS_FT_FI4 58) chain D residue 319 type BINDING sequence D description BINDING => ECO:0000269|PubMed:24141705 source Swiss-Prot : SWS_FT_FI4 59) chain D residue 366 type BINDING sequence R description BINDING => ECO:0000269|PubMed:24141705 source Swiss-Prot : SWS_FT_FI4 60) chain D residue 370 type BINDING sequence H description BINDING => ECO:0000269|PubMed:24141705 source Swiss-Prot : SWS_FT_FI4 61) chain D residue 167 type BINDING sequence H description BINDING => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI5 62) chain D residue 206 type BINDING sequence R description BINDING => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI5 63) chain D residue 207 type BINDING sequence N description BINDING => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI5 64) chain D residue 311 type BINDING sequence D description BINDING => ECO:0000269|PubMed:24141705, ECO:0000269|PubMed:24217394, ECO:0000269|PubMed:25288794, ECO:0000269|PubMed:25760601, ECO:0000269|PubMed:26431200 source Swiss-Prot : SWS_FT_FI5 65) chain D residue 467 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI7 66) chain D residue 469 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI7 67) chain D residue 492 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links