eF-site ID 6cf3-A PDB Code 6cf3 Chain A click to enlarge Title Ethylene forming enzyme Y306A variant in complex with manganese and 2-oxoglutarate Classification OXIDOREDUCTASE Compound 2-oxoglutarate-dependent ethylene/succinate-forming enzyme Source (EFE_PSESH) Sequence A:  LQTFELPTEVTGCAADISLGRALIQAWQKDGIFQIKTDSE QDRKTQEAMAASKQFCKEPLTFKSSCVSDLTYSGYVASGE EVTAGKPDFPEIFTVCKDLSVGDQRVKAGWPCHGPVPWPN NTYQKSMKTFMEELGLAGERLLKLTALGFELPINTFTDLT RDGWHHMRVLRFPPQTSTLSRGIGAHTDYGLLVIAAQDDV GGLYIRPPVEGEKRNRNWLPGESSAGMFEHDEPWTFVTPT PGVWTVFPGDILQFMTGGQLLSTPHKVKLNTRERFACAYF HEPNFEASAYPLFEPSANERIHAGEHFTNMFMRCYPDRIT TQRINKENRLAH Description Functional site 1) chain A residue 189 type sequence H description binding site for residue MN A 401 source : AC1 2) chain A residue 191 type sequence D description binding site for residue MN A 401 source : AC1 3) chain A residue 268 type sequence H description binding site for residue MN A 401 source : AC1 4) chain A residue 171 type sequence R description binding site for residue AKG A 402 source : AC2 5) chain A residue 173 type sequence L description binding site for residue AKG A 402 source : AC2 6) chain A residue 175 type sequence F description binding site for residue AKG A 402 source : AC2 7) chain A residue 186 type sequence I description binding site for residue AKG A 402 source : AC2 8) chain A residue 189 type sequence H description binding site for residue AKG A 402 source : AC2 9) chain A residue 191 type sequence D description binding site for residue AKG A 402 source : AC2 10) chain A residue 206 type sequence L description binding site for residue AKG A 402 source : AC2 11) chain A residue 268 type sequence H description binding site for residue AKG A 402 source : AC2 12) chain A residue 270 type sequence V description binding site for residue AKG A 402 source : AC2 13) chain A residue 277 type sequence R description binding site for residue AKG A 402 source : AC2 14) chain A residue 279 type sequence A description binding site for residue AKG A 402 source : AC2 15) chain A residue 169 type sequence H description binding site for residue EDO A 403 source : AC3 16) chain A residue 191 type sequence D description binding site for residue EDO A 403 source : AC3 17) chain A residue 192 type sequence Y description binding site for residue EDO A 403 source : AC3 18) chain A residue 189 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00805 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 268 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00805 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links