eF-site ID 6cbi-E PDB Code 6cbi Chain E click to enlarge Title PCNA in complex with inhibitor Classification CELL CYCLE Compound Proliferating cell nuclear antigen Source (6CBI) Sequence E:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVI SCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMN EPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK IADMGHLKYYLAPKI Description (1)  Proliferating cell nuclear antigen, GLY-ARG-LYS-ARG-ARG-GLN-DAB-SER-MET-THR-GLU-PHE-TYR-HIS Functional site 1) chain E residue 45 type sequence V description binding site for Di-peptide GLN K 144 and DAB K 145 source : AD3 2) chain E residue 252 type sequence A description binding site for Di-peptide GLN K 144 and DAB K 145 source : AD3 3) chain E residue 253 type sequence P description binding site for Di-peptide GLN K 144 and DAB K 145 source : AD3 4) chain E residue 252 type sequence A description binding site for Di-peptide DAB K 145 and GLU K 149 source : AD4 5) chain E residue 253 type sequence P description binding site for Di-peptide DAB K 145 and GLU K 149 source : AD4 6) chain E residue 44 type sequence H description binding site for Di-peptide DAB K 145 and SER K 146 source : AD5 7) chain E residue 252 type sequence A description binding site for Di-peptide DAB K 145 and SER K 146 source : AD5 8) chain E residue 253 type sequence P description binding site for Di-peptide DAB K 145 and SER K 146 source : AD5 9) chain E residue 254 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI6 10) chain E residue 77 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 11) chain E residue 80 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 12) chain E residue 248 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 13) chain E residue 211 type MOD_RES sequence Y description Phosphotyrosine; by EGFR => ECO:0000269|PubMed:17115032 source Swiss-Prot : SWS_FT_FI4 14) chain E residue 164 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:17108083, ECO:0000269|PubMed:17130289 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links