eF-site ID 6cbi-D PDB Code 6cbi Chain D click to enlarge Title PCNA in complex with inhibitor Classification CELL CYCLE Compound Proliferating cell nuclear antigen Source (6CBI) Sequence D:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD LDVLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISC AKDGVKFSASGELGNGNIKLSQTKEEEAVTIEMNEPVQLT FALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGH LKYYLAPKI Description (1)  Proliferating cell nuclear antigen, GLY-ARG-LYS-ARG-ARG-GLN-DAB-SER-MET-THR-GLU-PHE-TYR-HIS Functional site 1) chain D residue 42 type sequence S description binding site for residue SO4 D 301 source : AC2 2) chain D residue 45 type sequence V description binding site for Di-peptide GLN J 144 and DAB J 145 source : AC9 3) chain D residue 252 type sequence A description binding site for Di-peptide GLN J 144 and DAB J 145 source : AC9 4) chain D residue 253 type sequence P description binding site for Di-peptide GLN J 144 and DAB J 145 source : AC9 5) chain D residue 254 type sequence K description binding site for Di-peptide GLN J 144 and DAB J 145 source : AC9 6) chain D residue 252 type sequence A description binding site for Di-peptide DAB J 145 and GLU J 149 source : AD1 7) chain D residue 253 type sequence P description binding site for Di-peptide DAB J 145 and GLU J 149 source : AD1 8) chain D residue 44 type sequence H description binding site for Di-peptide DAB J 145 and SER J 146 source : AD2 9) chain D residue 252 type sequence A description binding site for Di-peptide DAB J 145 and SER J 146 source : AD2 10) chain D residue 253 type sequence P description binding site for Di-peptide DAB J 145 and SER J 146 source : AD2 11) chain D residue 61-80 type MOD_RES sequence RCDRNLAMGVNLTSMSKILK description Phosphothreonine; by PKA, PKB/AKT1, PIM1 and PIM2 => ECO:0000269|PubMed:10753973, ECO:0000269|PubMed:11463845, ECO:0000269|PubMed:12431783, ECO:0000269|PubMed:16982699, ECO:0000269|PubMed:20307683 source Swiss-Prot : SWS_FT_FI1 12) chain D residue 14 type MOD_RES sequence K description Phosphoserine; by PKC and NUAK1 => ECO:0000269|PubMed:10753973, ECO:0000269|PubMed:25329316 source Swiss-Prot : SWS_FT_FI2 13) chain D residue 77 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 14) chain D residue 80 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 15) chain D residue 248 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 16) chain D residue 211 type MOD_RES sequence Y description Phosphotyrosine; by EGFR => ECO:0000269|PubMed:17115032 source Swiss-Prot : SWS_FT_FI4 17) chain D residue 164 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:17108083, ECO:0000269|PubMed:17130289 source Swiss-Prot : SWS_FT_FI5 18) chain D residue 254 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links