eF-site ID 6cbi-C PDB Code 6cbi Chain C click to enlarge Title PCNA in complex with inhibitor Classification CELL CYCLE Compound Proliferating cell nuclear antigen Source (6CBI) Sequence C:  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM DSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD LDVEQPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCA KDGVKFSASGELGNGNIKLSQTEEEAVTIEMNEPVQLTFA LRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLK YYLAPKI Description (1)  Proliferating cell nuclear antigen, GLY-ARG-LYS-ARG-ARG-GLN-DAB-SER-MET-THR-GLU-PHE-TYR-HIS Functional site 1) chain C residue 45 type sequence V description binding site for Di-peptide GLN H 144 and DAB H 145 source : AC3 2) chain C residue 252 type sequence A description binding site for Di-peptide GLN H 144 and DAB H 145 source : AC3 3) chain C residue 253 type sequence P description binding site for Di-peptide GLN H 144 and DAB H 145 source : AC3 4) chain C residue 254 type sequence K description binding site for Di-peptide GLN H 144 and DAB H 145 source : AC3 5) chain C residue 44 type sequence H description binding site for Di-peptide DAB H 145 and SER H 146 source : AC4 6) chain C residue 252 type sequence A description binding site for Di-peptide DAB H 145 and SER H 146 source : AC4 7) chain C residue 253 type sequence P description binding site for Di-peptide DAB H 145 and SER H 146 source : AC4 8) chain C residue 252 type sequence A description binding site for Di-peptide DAB H 145 and GLU H 149 source : AC5 9) chain C residue 253 type sequence P description binding site for Di-peptide DAB H 145 and GLU H 149 source : AC5 10) chain C residue 254 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI6 11) chain C residue 77 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 12) chain C residue 80 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 13) chain C residue 248 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 14) chain C residue 211 type MOD_RES sequence Y description Phosphotyrosine; by EGFR => ECO:0000269|PubMed:17115032 source Swiss-Prot : SWS_FT_FI4 15) chain C residue 164 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:17108083, ECO:0000269|PubMed:17130289 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links