eF-site ID 6cb1-p
PDB Code 6cb1
Chain p

click to enlarge
Title Yeast nucleolar pre-60S ribosomal subunit (state 3)
Classification RIBOSOME
Compound 35S pre-ribosomal RNA miscRNA
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae BY4741;
Sequence p:  EKFEELKLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRD
VLGAAKTGSGKTLAFLIPAIELLHSLKFKPRNGTGIIVIT
PTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL
MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRI
LEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARI
SLRPGPLFINVLEQGYVVCDSDKRFLLLFSFLKRNQKKKI
IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTF
FEFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRD
YIHRVGRTARGTKGKGKSLMFLTPNELGFLRYLKASKVPL
NEYEFPENKIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQ
AYASHSLKTVYQIDKLDLAKVAKSYGFPVPPKVNITI
Description (1)  pre-60S ribosomal subunit

Display surface

Download
Links