eF-site ID 6cb1-M
PDB Code 6cb1
Chain M

click to enlarge
Title Yeast nucleolar pre-60S ribosomal subunit (state 3)
Classification RIBOSOME
Compound 35S pre-ribosomal RNA miscRNA
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae BY4741;
Sequence M:  NWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPK
AGVPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAAV
CEKWAASSWAKKIAQRERRAALTDFERFQVMVLRKQKRYT
VKKALAKA
Description (1)  pre-60S ribosomal subunit

Display surface

Download
Links