eF-site ID 6c84-B
PDB Code 6c84
Chain B

click to enlarge
Title Crystal structure of PBP5 from Enterococcus faecium
Classification MEMBRANE PROTEIN
Compound Penicillin-binding protein
Source (A0A133MY97_ENTFC)
Sequence B:  ETQAVEAGEKTVEQFVQALNKGDYNKAAGMASKKAANKSA
LSEKEILEKYQNIYGAADVKGLEISNLKVDKKDDSTYSFS
YKAKMNTSLGELKDLSYKGTLDRNDGKTTINWQPNLVFPE
MEGNDKVSLTTQEATRGNILDRNGEPLATTGKLKQLGVVP
SKLGDGDEKTANIKAIASAFDLTEDAINQAISQSWVQPDY
FVPLKIIDGATPELPAGATIQEVDGRYYPLGEAAAQLIGY
VGDITAEDIDKNPELSSNGKIGRSGLEMAFDKDLRGTTGG
KLSITDTDGVEKKVLIEHEVQNGKDIKLTIDAKAQKTAFD
SLGGKAGSTVATTPKTGDLLALASSPSYDPNKMTNGISQE
DYKAYEENPEQPFISRFATGYAPGSTFKMITAAIGLDNGT
IDPNEVLTINGLKWQKDSSWGSYQVTRVSDVSQVDLKTAL
IYSDNIYMAQETLKMGEKNFRAGLDKFIFGEDLDLPISMN
PAQISNEESFNSDILLADTGYGQGELLINPIQQAAMYSVF
ANNGTLVYPKLIADKETKDKKNVIGETAVQTIVPDLREVV
QDVNGTAHSLSALGIPLAAKTGTAEIKEKQDEKGKENSFL
FAFNPDNQEYMMVSMLENKEDDDSATKRAPELLQYLNQNY
Q
Description (1)  Penicillin-binding protein

Display surface

Download
Links