eF-site ID 6c44_2-AB
PDB Code 6c44
Model 2
Chain A, B

click to enlarge
Title Zika virus capsid protein
Classification VIRAL PROTEIN
Compound Capsid protein
Source (A0A1V0E2H9_ZIKV)
Sequence A:  AGLLLGHGPIRMVLAILAFLRFTAIKPSLGLINRWGSVGK
KEAMEIIKKFKKDLAAMLRIINARKEKKRR
B:  AGLLLGHGPIRMVLAILAFLRFTAIKPSLGLINRWGSVGK
KEAMEIIKKFKKDLAAMLRIINARKEKKRR
Description (1)  Capsid protein

Display surface

Download
Links