eF-site ID 6bpq-A
PDB Code 6bpq
Chain A

click to enlarge
Title Structure of the cold- and menthol-sensing ion channel TRPM8
Classification TRANSPORT PROTEIN
Compound Transient receptor potential cation channel subfamily M member 8
Source (6BPQ)
Sequence A:  XXXXXXXXXXXXXXXXXXXXCDTDSETLYDLMTQHWHLKT
PNLVISVTKNFALKPRMRKIFSRLIYIAQSKGAWIFTGLM
KYIGEVVRDNTISRSSEENVVAIGIAXXXXXLKRDPLYCL
DNNHTHLLLVEAKVRTQLEKYISERVIPESNYGGKIPIVC
FAQGGGKETLKSINVAIKSKIPCVVVEGSIADVIASLVSS
CVKESLLRFLPRTISRLSEEETESWIKWIKEVLESPHLLT
VIKIEIVSNAISFALYKAFSTNEHDRDNWNGQLKLLLEWN
QLDLASDEIFTNDRNWESADLQDVMFTALVKDRPKFVRLF
LENGLNLRKFLTTEVLRELYTNNFSSLVFKNLQIAKNSYN
DALLTFVWKMVEDFRRGRHPLQALFIWSVLQNKKELSKVI
WEQTRGCTLAALGASKLLKSMAKVKNDINAAGESEELANE
YETRAVELFTECYSNDEDLAEQLLTYSCEAWGGSNCLELA
VEARDQQFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLF
FFPLIGCGFISFRKKKLFLYYVSFFTSPFVVFSWNVIFYI
AFLLLFAYVLLMDFQKEPTALEIILYVLVFILLCDEVRQW
YMNGSKYFSDLWNVMDTLAIFYFIAGIVFRLHSSSWYSGR
VIFCLDYIVFTLRLIHIFTVSRNLGPKIIMLQRMMIDVFF
FLFLFAVWMVAFGVARQGILRWEWIFRSVIYEPYLAMNNQ
PRFPEWITIPLVCIYMLSTNILLVNLLVADQVWKFQRFFL
VQEYCSRLTXXXXXXXXXXXXXXXXXXRNEDNEILAWEAV
MKENYLVKINTXXXXXXXXXXXXXXXXXXXXXXXX
Description (1)  Transient receptor potential cation channel subfamily M member 8

Display surface

Download
Links