eF-site ID 6bl6-B
PDB Code 6bl6
Chain B

click to enlarge
Title Crystallization of lipid A transporter MsbA from Salmonella typhimurium: a novel perspective on its transport
Classification MEMBRANE PROTEIN
Compound Lipid A export ATP-binding/permease protein MsbA
Source (MSBA_SALTY)
Sequence B:  LSTWQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLS
LLKPLLDDGFGATDRSVLLWMPLVVIGLMILRGITSYISS
YCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQSTGTLLS
RITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQ
LSIILVVLAPIVSIAIRVVSKRFRSISKNMQNTMGQVTTS
AEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQGMKMVS
ASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITV
VFSSMIALMRPLKSLTNVNAQFQRGMAACQTLFAILDSEQ
EKDEGKRVIDRATGDLEFRNVTFTYPGREVPALRNINLKI
PAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHD
LREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYS
REQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSGGQR
QRIAIARALLRDSPILILDEATSALDTESERAIQAALDEL
QKNRTSLVIAHRLSTIEQADEIVVVEDGIIVERGTHSELL
AQHGVYAQLHKMQFG
Description (1)  Lipid A export ATP-binding/permease protein MsbA (E.C.3.6.3.-)

Display surface

Download
Links