eF-site ID 6bay-B PDB Code 6bay Chain B click to enlarge Title Stigmatella aurantiaca bacterial phytochrome P1, PAS-GAF-PHY T289H mutant, room temperature structure Classification SIGNALING PROTEIN Compound Photoreceptor-histidine kinase BphP Source (Q097N3_STIAD) Sequence B:  QEVDLTNCDREPIHIPGAIQPHGVLLVLSEPGLVLTHASE NAPAVLGNSAEQLLGAPLGHFIEPSVREPLEADLRSARLK QLNPLKVVWRVDGVDRFFDGIAHRHQGRLILELEPSSHRE AVPFLSFFHAVRDGLSRLRDARDLQELCEAVVQEVRGLTG FDRAIIYRFDAEWNGSVIAEARDARADPYLGLHFPASDIP RQARELYQLNWLRIIPTIDYQPARVRALPGHGEPLDLSFS VLRSVSPIHLEYLHNMGVQASMSISLMKDGKLWGLISCHQ VSGTRYVPYEVRTACEFLGEVMSSLLAAKEGNEDYDQRIR AKSIHAALLERMAREVDFVSGLASQESGLLELVHAHGAAI HFHGRTTVLGQAPSDEALTGLIEWLGSRTGEGVFCTDRLA REYPEAQAFQEVAAGLMAFSMSRGRNNFVLWFRPEAVQTV NWSGNPTKAVEFDQGGPRLHPRKSFELWKETVRGRCLPWK AYEVEAASELRRSIIDVALQRSEEL Description Functional site 1) chain B residue 16 type sequence T description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 2) chain B residue 17 type sequence N description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 3) chain B residue 19 type sequence D description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 4) chain B residue 20 type sequence R description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 5) chain B residue 21 type sequence E description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 6) chain B residue 175 type sequence I description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 7) chain B residue 177 type sequence Y description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 8) chain B residue 187 type sequence V description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 9) chain B residue 204 type sequence F description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 10) chain B residue 207 type sequence S description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 11) chain B residue 208 type sequence D description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 12) chain B residue 209 type sequence I description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 13) chain B residue 210 type sequence P description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 14) chain B residue 212 type sequence Q description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 15) chain B residue 217 type sequence Y description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 16) chain B residue 225 type sequence I description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 17) chain B residue 253 type sequence R description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 18) chain B residue 255 type sequence V description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 19) chain B residue 256 type sequence S description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 20) chain B residue 258 type sequence I description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 21) chain B residue 259 type sequence H description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 22) chain B residue 262 type sequence Y description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 23) chain B residue 271 type sequence S description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 24) chain B residue 273 type sequence S description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 25) chain B residue 287 type sequence S description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 26) chain B residue 289 type sequence H description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 27) chain B residue 459 type sequence A description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 28) chain B residue 460 type sequence V description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2 29) chain B residue 469 type sequence L description binding site for Di-peptide BLR B 601 and CYS B 18 source : AC2

Display surface Download Links