eF-site ID 6bap-C PDB Code 6bap Chain C click to enlarge Title Stigmatella aurantiaca bacterial phytochrome PAS-GAF-PHY, T289H mutant Classification SIGNALING PROTEIN Compound Photoreceptor-histidine kinase BphP Source (Q097N3_STIAD) Sequence C:  TNCDREPIHIPGAIQPHGVLLVLSEPGLVLTHASENAPAV LGNSAEQLLGAPLGHFIEPSVREPLEADLRSARLKQLNPL KVVWRVDGVDRFFDGIAHRHQGRLILELEPSSHREAVPFL SFFHAVRDGLSRLRDARDLQELCEAVVQEVRGLTGFDRAI IYRFDAEWNGSVIAEARDARADPYLGLHFPASDIPRQARE LYQLNWLRIIPTIDYQPARVRALPGHGEPLDLSFSVLRSV SPIHLEYLHNMGVQASMSISLMKDGKLWGLISCHQVSGTR YVPYEVRTACEFLGEVMSSLLAAKEGNEDYDQRIRAKSIH AALLERMAREVDFVSGLASQESGLLELVHAHGAAIHFHGR TTVLGQAPSDEALTGLIEWLGSRTGEGVFCTDRLAREYPE AQAFQEVAAGLMAFSMSRGRNNFVLWFRPEAVQTVNWSGN PTKAVEFDQGGPRLHPRKSFELWKETVRGRCLPWKAYEVE AASELRRSIIDVALQRSEEL Description Functional site 1) chain C residue 17 type sequence N description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 2) chain C residue 19 type sequence D description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 3) chain C residue 20 type sequence R description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 4) chain C residue 21 type sequence E description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 5) chain C residue 177 type sequence Y description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 6) chain C residue 204 type sequence F description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 7) chain C residue 207 type sequence S description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 8) chain C residue 208 type sequence D description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 9) chain C residue 209 type sequence I description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 10) chain C residue 210 type sequence P description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 11) chain C residue 217 type sequence Y description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 12) chain C residue 223 type sequence R description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 13) chain C residue 225 type sequence I description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 14) chain C residue 253 type sequence R description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 15) chain C residue 255 type sequence V description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 16) chain C residue 256 type sequence S description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 17) chain C residue 258 type sequence I description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 18) chain C residue 259 type sequence H description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 19) chain C residue 262 type sequence Y description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 20) chain C residue 271 type sequence S description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 21) chain C residue 272 type sequence M description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 22) chain C residue 273 type sequence S description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 23) chain C residue 287 type sequence S description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 24) chain C residue 289 type sequence H description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3 25) chain C residue 471 type sequence P description binding site for Di-peptide BLR C 601 and CYS C 18 source : AC3

Display surface Download Links