eF-site ID 6at1-D PDB Code 6at1 Chain D click to enlarge Title STRUCTURAL CONSEQUENCES OF EFFECTOR BINDING TO THE T STATE OF ASPARTATE CARBAMOYLTRANSFERASE. CRYSTAL STRUCTURES OF THE UNLIGATED AND ATP-, AND CTP-COMPLEXED ENZYMES AT 2.6-ANGSTROMS RESOLUTION Classification TRANSFERASE (CARBAMOYL-P,ASPARTATE) Compound ASPARTATE CARBAMOYLTRANSFERASE (T STATE), CATALYTIC CHAIN Source Escherichia coli (strain K12) (PYRI_ECOLI) Sequence D:  GVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLN LPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQATVNRID NYEVVGKSRPSLPERIDNVLVCPNSNCISHAEPVSSSFAV RKRANDIALKCKYCEKEFSHNVVLAN Description Functional site 1) chain D residue 109 type sequence C description zinc binding site source : ZND 2) chain D residue 114 type sequence C description zinc binding site source : ZND 3) chain D residue 138 type sequence C description zinc binding site source : ZND 4) chain D residue 141 type sequence C description zinc binding site source : ZND 5) chain D residue 109 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 6) chain D residue 114 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 7) chain D residue 138 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 8) chain D residue 141 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 9) chain D residue 110 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI1 10) chain D residue 115 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 11) chain D residue 139 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 12) chain D residue 142 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links