eF-site ID 6aks-D
PDB Code 6aks
Chain D

click to enlarge
Title Cryo-EM structure of CVA10 mature virus
Classification VIRUS
Compound VP1
Source (Q75Q92_9ENTO)
Sequence D:  ATGGSTINFTNINYYKDSYAASATRQDFTQDPKKFTQPVL
DSIRELSAPLN
Description (1)  VP1, VP2, VP3, VP4

Display surface

Download
Links