eF-site ID 6aks-C
PDB Code 6aks
Chain C

click to enlarge
Title Cryo-EM structure of CVA10 mature virus
Classification VIRUS
Compound VP1
Source (Q75Q92_9ENTO)
Sequence C:  GIPAELRPGTNQFLTTDDDTAAPILPGFTPTPTIHIPGEV
HSLLELCRVETILEVNNTTEATGLTRLLIPVSSQNKADEL
CAAFMVDPGRIGPWQSTLVGQICRYYTQWSGSLKVTFMFT
GSFMATGKMLVAYSPPGSAQPANRETAMLGTHVIWDFGLQ
SSVSLVIPWISNTHFRTAKTGGNYDYYTAGVVTLWYQTNY
VVPPETPGEAYIIAMGADLYKFTLKICKDTDEVTQQAVLQ
Description (1)  VP1, VP2, VP3, VP4


Functional site

1) chain C
residue 24
type binding
ligand SPH: SPHINGOSINE
sequence I
description SPHINGOSINE binding site
source pdb_hetatom : SPH_6aks_A_300


Display surface

Download
Links