eF-site ID 6ahf-D PDB Code 6ahf Chain D click to enlarge Title CryoEM Reconstruction of Hsp104 N728A Hexamer Classification CHAPERONE Compound Heat shock protein 104 Source (HS104_YEAST) Sequence D:  QFTERALTILTLAQKLASDHQHPQLQPIHILAAFIETPED GSVPYLQNLIEKGRYDYDLFKKVVNRNLVRIPQQQPAPAE ITPSYALGKVLQDAAKIQKQQKDSFIAQDHILFALFNDSS IQQIFKEAQVDIEAIKQQALELRGNTRIDSRGADTNTPLE YLSKYAIDMTEQARQGKLDPVIGREEEIRSTIRVLARRIK SNPCLIGEPGIGKTAIIEGVAQRIIDDDVPTILQGAKLFS LDLAALTAGAKYKGDFEERFKGVLKEIEESKTLIVLFIDE IHMLMGNGKDDAANILKPALSRGQLKVIGATTNNEYRSIV EKDGAFERRFQKIEVAEPSVRQTVAILRGLQPKYEIHHGV RILDSALVTAAQLAKRYLPYRRLPDSALDLVDISCAGVAV ARDSKPEELDSKERQLQLIQVEIKALERDEDADSTTKDRL KLARQKEASLQEELEPLRQRYNEEKHGHEELTQAKKKLDE LENKALDAERRYDTATAADLRYFAIPDIKKQIEKLEDQVA EEERRAGANSMIQNVVDSDTISETAARLTGIPVKKLSESE NEKLIHMERDLSSEVVGQMDAIKAVSNAVRLSRSGLANPR QPASFLFLGLSGSGKTELAKKVAGFLFNDEDMMIRVDCSE LSEKYAVSKLLGTTAGYVGYDEGGFLTNQLQYKPYSVLLF DEVEKAHPDVLTVMLQMLDDGRITSGQGKTIDCSNCIVIM TSALGAEFINSQQGSKIQESTKNLVMGAVRQHFRPEFLNR ISSIVIFNKLSRKAIHKIVDIRLKEIEERFEQNDKHYKLN LTQEAKDFLAKYGYSDDMGARPLNRLIQNEILNKLALRIL KNEIKDKETVNVVLEAEECLEVLPN Description (1)  Heat shock protein 104 Functional site 1) chain D residue 186 type sequence V description binding site for residue AGS D 1001 source : AC2 2) chain D residue 187 type sequence I description binding site for residue AGS D 1001 source : AC2 3) chain D residue 213 type sequence E description binding site for residue AGS D 1001 source : AC2 4) chain D residue 214 type sequence P description binding site for residue AGS D 1001 source : AC2 5) chain D residue 215 type sequence G description binding site for residue AGS D 1001 source : AC2 6) chain D residue 216 type sequence I description binding site for residue AGS D 1001 source : AC2 7) chain D residue 217 type sequence G description binding site for residue AGS D 1001 source : AC2 8) chain D residue 218 type sequence K description binding site for residue AGS D 1001 source : AC2 9) chain D residue 221 type sequence I description binding site for residue AGS D 1001 source : AC2 10) chain D residue 351 type sequence I description binding site for residue AGS D 1001 source : AC2 11) chain D residue 390 type sequence D description binding site for residue AGS D 1001 source : AC2 12) chain D residue 393 type sequence L description binding site for residue AGS D 1001 source : AC2 13) chain D residue 333 type sequence R description binding site for residue AGS E 1001 source : AC3 14) chain D residue 761 type sequence E description binding site for residue AGS E 1002 source : AC4 15) chain D residue 211 type sequence I description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 16) chain D residue 285 type sequence E description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 17) chain D residue 315 type sequence A description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 18) chain D residue 316 type sequence T description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 19) chain D residue 317 type sequence T description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 20) chain D residue 318 type sequence N description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 21) chain D residue 319 type sequence N description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 22) chain D residue 320 type sequence E description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 23) chain D residue 322 type sequence R description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 24) chain D residue 323 type sequence S description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 25) chain D residue 324 type sequence I description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 26) chain D residue 325 type sequence V description binding site for Ligand TYR D 321 bound to THR D 317 source : AC7 27) chain D residue 211 type sequence I description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 28) chain D residue 285 type sequence E description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 29) chain D residue 315 type sequence A description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 30) chain D residue 316 type sequence T description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 31) chain D residue 317 type sequence T description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 32) chain D residue 318 type sequence N description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 33) chain D residue 319 type sequence N description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 34) chain D residue 320 type sequence E description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 35) chain D residue 322 type sequence R description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 36) chain D residue 323 type sequence S description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 37) chain D residue 324 type sequence I description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 38) chain D residue 325 type sequence V description binding site for Ligand TYR D 321 bound to THR D 317 source : AC8 39) chain D residue 204 type sequence I description binding site for Di-peptide ARG E 203 and TYR F 359 source : AC9 40) chain D residue 204 type sequence I description binding site for Di-peptide ILE E 204 and TYR F 359 source : AD1 41) chain D residue 212 type BINDING sequence G description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 42) chain D residue 614 type BINDING sequence G description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 43) chain D residue 206 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956, ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI3 44) chain D residue 306 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI4 45) chain D residue 535 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI4 46) chain D residue 499 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI5 47) chain D residue 442 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI6 48) chain D residue 620 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:14557538 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links