eF-site ID 6agp_15-A PDB Code 6agp Model 15 Chain A click to enlarge Title Structure of Rac1 in the low-affinity state for Mg2+ Classification SIGNALING PROTEIN Compound Ras-related C3 botulinum toxin substrate 1 Source (RAC1_HUMAN) Sequence A:  MQAIKCVVVGDGAVGKTCLLISYTTNAFPGCYIPTVFDNY SANVMVDGKPVNLGLWDTAGQECYDRLRPLSYPCTDVFLI CFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSAC TQRGLKTVFDEAIRAVLCPPP Description (1)  Ras-related C3 botulinum toxin substrate 1 Functional site 1) chain A residue 11 type sequence D description binding site for residue GDP A 201 source : AC1 2) chain A residue 12 type sequence G description binding site for residue GDP A 201 source : AC1 3) chain A residue 13 type sequence A description binding site for residue GDP A 201 source : AC1 4) chain A residue 14 type sequence V description binding site for residue GDP A 201 source : AC1 5) chain A residue 15 type sequence G description binding site for residue GDP A 201 source : AC1 6) chain A residue 16 type sequence K description binding site for residue GDP A 201 source : AC1 7) chain A residue 17 type sequence T description binding site for residue GDP A 201 source : AC1 8) chain A residue 18 type sequence C description binding site for residue GDP A 201 source : AC1 9) chain A residue 116 type sequence K description binding site for residue GDP A 201 source : AC1 10) chain A residue 118 type sequence D description binding site for residue GDP A 201 source : AC1 11) chain A residue 119 type sequence L description binding site for residue GDP A 201 source : AC1 12) chain A residue 159 type sequence A description binding site for residue GDP A 201 source : AC1 13) chain A residue 160 type sequence C description binding site for residue GDP A 201 source : AC1 14) chain A residue 17 type sequence T description binding site for residue MG A 202 source : AC2 15) chain A residue 147 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:18093184 source Swiss-Prot : SWS_FT_FI8 16) chain A residue 166 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:23512198 source Swiss-Prot : SWS_FT_FI9 17) chain A residue 60 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11090627, ECO:0007744|PDB:1E96, ECO:0007744|PDB:2WKP, ECO:0007744|PDB:2WKQ, ECO:0007744|PDB:2WKR source Swiss-Prot : SWS_FT_FI1 18) chain A residue 13 type BINDING sequence A description BINDING => ECO:0000269|PubMed:11090627, ECO:0007744|PDB:1E96, ECO:0007744|PDB:2WKP, ECO:0007744|PDB:2WKQ, ECO:0007744|PDB:2WKR source Swiss-Prot : SWS_FT_FI1 19) chain A residue 30 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11090627, ECO:0007744|PDB:1E96, ECO:0007744|PDB:2WKP, ECO:0007744|PDB:2WKQ, ECO:0007744|PDB:2WKR source Swiss-Prot : SWS_FT_FI1 20) chain A residue 159 type BINDING sequence A description BINDING => ECO:0000269|PubMed:11090627, ECO:0007744|PDB:1E96, ECO:0007744|PDB:2WKP, ECO:0007744|PDB:2WKQ, ECO:0007744|PDB:2WKR, ECO:0007744|PDB:5HZH source Swiss-Prot : SWS_FT_FI2 21) chain A residue 116 type BINDING sequence K description BINDING => ECO:0000269|PubMed:11090627, ECO:0007744|PDB:1E96, ECO:0007744|PDB:2WKP, ECO:0007744|PDB:2WKQ, ECO:0007744|PDB:2WKR, ECO:0007744|PDB:5HZH source Swiss-Prot : SWS_FT_FI2 22) chain A residue 32 type MOD_RES sequence Y description (Microbial infection) O-AMP-tyrosine; by Haemophilus IbpA; alternate => ECO:0000269|PubMed:19362538 source Swiss-Prot : SWS_FT_FI3 23) chain A residue 35 type MOD_RES sequence T description (Microbial infection) O-AMP-threonine; by Vibrio VopS => ECO:0000269|PubMed:19039103 source Swiss-Prot : SWS_FT_FI4 24) chain A residue 71 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:10617634 source Swiss-Prot : SWS_FT_FI5 25) chain A residue 32 type CARBOHYD sequence Y description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI6 26) chain A residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB, and by P.sordellii toxin TcsL; alternate => ECO:0000269|PubMed:19744486, ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links