eF-site ID 6ad9-AB PDB Code 6ad9 Chain A, B click to enlarge Title Crystal Structure of PPARgamma Ligand Binding Domain in complex with dibenzooxepine derivative compound-9 Classification NUCLEAR PROTEIN Compound Peroxisome proliferator-activated receptor gamma Source (PRGC1_HUMAN) Sequence A:  SADLRALAKHLYDSYIKSFPLTKAKARAILTGKTDKSPFV IYDMNSLMMGEDKKEVAIRIFQGCQFRSVEAVQEITEYAK SIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLI SEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDD SDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQL KLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTET DMSLHPLLQEIYKDL B:  PSLLKKLLLA Description Functional site 1) chain A residue 282 type sequence F description binding site for residue KK4 A 501 source : AC1 2) chain A residue 283 type sequence Q description binding site for residue KK4 A 501 source : AC1 3) chain A residue 285 type sequence C description binding site for residue KK4 A 501 source : AC1 4) chain A residue 286 type sequence Q description binding site for residue KK4 A 501 source : AC1 5) chain A residue 289 type sequence S description binding site for residue KK4 A 501 source : AC1 6) chain A residue 323 type sequence H description binding site for residue KK4 A 501 source : AC1 7) chain A residue 327 type sequence Y description binding site for residue KK4 A 501 source : AC1 8) chain A residue 341 type sequence I description binding site for residue KK4 A 501 source : AC1 9) chain A residue 363 type sequence F description binding site for residue KK4 A 501 source : AC1 10) chain A residue 364 type sequence M description binding site for residue KK4 A 501 source : AC1 11) chain A residue 449 type sequence H description binding site for residue KK4 A 501 source : AC1 12) chain A residue 473 type sequence Y description binding site for residue KK4 A 501 source : AC1 13) chain B residue 608 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 323 type MOD_RES sequence H description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 449 type MOD_RES sequence H description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 473 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 224 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:36737649 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links