eF-site ID 6a91-B PDB Code 6a91 Chain B click to enlarge Title Complex of voltage-gated sodium channel NavPaS from American cockroach Periplaneta americana bound with saxitoxin and Dc1a Classification MEMBRANE PROTEIN/TOXIN Compound Sodium channel protein PaFPC1 Source (TXI92_DIGCA) Sequence B:  SAKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDC RCLKSGFFSSKCVCRDV Description (1)  Sodium channel protein PaFPC1, Mu-diguetoxin-Dc1a Functional site 1) chain B residue 21 type SITE sequence D description Interacts with insect Nav channel => ECO:0000269|PubMed:30049784 source Swiss-Prot : SWS_FT_FI1 2) chain B residue 33 type SITE sequence Y description Interacts with insect Nav channel => ECO:0000269|PubMed:30049784 source Swiss-Prot : SWS_FT_FI1 3) chain B residue 41 type SITE sequence R description Interacts with insect Nav channel => ECO:0000269|PubMed:30049784 source Swiss-Prot : SWS_FT_FI1 4) chain B residue 44 type SITE sequence K description Interacts with insect Nav channel => ECO:0000269|PubMed:30049784 source Swiss-Prot : SWS_FT_FI1 5) chain B residue 48 type SITE sequence F description Interacts with insect Nav channel => ECO:0000269|PubMed:30049784 source Swiss-Prot : SWS_FT_FI1 6) chain B residue 49 type SITE sequence S description Interacts with insect Nav channel => ECO:0000269|PubMed:30049784 source Swiss-Prot : SWS_FT_FI1 7) chain B residue 56 type SITE sequence D description Interacts with insect Nav channel => ECO:0000269|PubMed:30049784 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links