eF-site ID 6a7k-B PDB Code 6a7k Chain B click to enlarge Title X-ray structure of NdhS from T. elongatus Classification ELECTRON TRANSPORT Compound Tlr0636 protein Source (Q8DL61_THEEB) Sequence B:  DLIMTILPGMTVKVTNPNDTYYQFQGIVQRITDGKVAVLF EGGNWDKLVTFQASELEPV Description Functional site 1) chain B residue 35 type sequence T description binding site for residue ACY B 101 source : AC2 2) chain B residue 36 type sequence D description binding site for residue ACY B 101 source : AC2

Display surface Download Links