eF-site ID 6a7k-A PDB Code 6a7k Chain A click to enlarge Title X-ray structure of NdhS from T. elongatus Classification ELECTRON TRANSPORT Compound Tlr0636 protein Source (Q8DL61_THEEB) Sequence A:  MATDLIMTILPGMTVKVTNPNDTYYQFQGIVQRITDGKVA VLFEGGNWDKLVTFQASELEPV Description Functional site 1) chain A residue 16 type sequence K description binding site for residue ACY A 101 source : AC1 2) chain A residue 60 type sequence E description binding site for residue ACY A 101 source : AC1

Display surface Download Links