eF-site ID 6a5s-G PDB Code 6a5s Chain G click to enlarge Title Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif Classification TRANSCRIPTION Compound 14-3-3 protein gamma Source (6A5S) Sequence G:  DREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEER NLLSVAYKNVVGARRSSWRVISSIEQKTEKKIEMVRAYRE KIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMK GDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQP THPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAE LDTLNEDSYKDSTLIMQLLRDNLTLWTS Description Functional site 1) chain G residue 50 type sequence K description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 2) chain G residue 57 type sequence R description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 3) chain G residue 132 type sequence R description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 4) chain G residue 133 type sequence Y description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 5) chain G residue 174 type sequence G description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 6) chain G residue 177 type sequence L description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 7) chain G residue 178 type sequence N description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 8) chain G residue 215 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P61983 source Swiss-Prot : SWS_FT_FI7 9) chain G residue 234 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI8 10) chain G residue 235 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI9 11) chain G residue 133 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P61983 source Swiss-Prot : SWS_FT_FI5 12) chain G residue 145 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|Ref.7 source Swiss-Prot : SWS_FT_FI6 13) chain G residue 57 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:17085597 source Swiss-Prot : SWS_FT_FI1 14) chain G residue 132 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:17085597 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links