eF-site ID 6a5s-D PDB Code 6a5s Chain D click to enlarge Title Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif Classification TRANSCRIPTION Compound 14-3-3 protein gamma Source (6A5S) Sequence D:  DREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEER NLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMV RAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVF YLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISK EHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS Description Functional site 1) chain D residue 50 type sequence K description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 2) chain D residue 57 type sequence R description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 3) chain D residue 132 type sequence R description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 4) chain D residue 133 type sequence Y description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 5) chain D residue 174 type sequence G description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 6) chain D residue 177 type sequence L description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 7) chain D residue 178 type sequence N description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 8) chain D residue 57 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:17085597 source Swiss-Prot : SWS_FT_FI1 9) chain D residue 132 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:17085597 source Swiss-Prot : SWS_FT_FI1 10) chain D residue 71 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 11) chain D residue 133 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P61983 source Swiss-Prot : SWS_FT_FI5 12) chain D residue 145 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|Ref.7 source Swiss-Prot : SWS_FT_FI6 13) chain D residue 215 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P61983 source Swiss-Prot : SWS_FT_FI7 14) chain D residue 234 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI8 15) chain D residue 235 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links