eF-site ID 6a5s-D PDB Code 6a5s Chain D click to enlarge Title Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif Classification TRANSCRIPTION Compound 14-3-3 protein gamma Source (6A5S) Sequence D:  DREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEER NLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMV RAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVF YLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISK EHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS Description Functional site 1) chain D residue 50 type sequence K description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 2) chain D residue 57 type sequence R description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 3) chain D residue 132 type sequence R description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 4) chain D residue 133 type sequence Y description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 5) chain D residue 174 type sequence G description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 6) chain D residue 177 type sequence L description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 7) chain D residue 178 type sequence N description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5

Display surface Download Links