eF-site ID 6a5s-B PDB Code 6a5s Chain B click to enlarge Title Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif Classification TRANSCRIPTION Compound 14-3-3 protein gamma Source (6A5S) Sequence B:  DREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEER NLLSVAYKNVVGARRSSWRVISSIEQKTNEKKIEMVRAYR EKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKM KGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ PTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIA ELDTLNEDSYKDSTLIMQLLRDNLTLWTS Description Functional site 1) chain B residue 202 type sequence D description binding site for residue MG B 301 source : AC2 2) chain B residue 203 type sequence D description binding site for residue MG B 301 source : AC2 3) chain B residue 204 type sequence A description binding site for residue MG B 301 source : AC2 4) chain B residue 205 type sequence I description binding site for residue MG B 301 source : AC2 5) chain B residue 206 type sequence A description binding site for residue MG B 301 source : AC2 6) chain B residue 50 type sequence K description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 7) chain B residue 57 type sequence R description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 8) chain B residue 132 type sequence R description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 9) chain B residue 133 type sequence Y description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 10) chain B residue 174 type sequence G description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 11) chain B residue 177 type sequence L description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 12) chain B residue 178 type sequence N description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 13) chain B residue 225 type sequence L description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 14) chain B residue 215 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P61983 source Swiss-Prot : SWS_FT_FI7 15) chain B residue 234 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI8 16) chain B residue 235 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI9 17) chain B residue 133 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P61983 source Swiss-Prot : SWS_FT_FI5 18) chain B residue 145 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|Ref.7 source Swiss-Prot : SWS_FT_FI6 19) chain B residue 57 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:17085597 source Swiss-Prot : SWS_FT_FI1 20) chain B residue 132 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:17085597 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links