eF-site ID 6a5s-ABCDEFGH PDB Code 6a5s Chain A, B, C, D, E, F, G, H click to enlarge Title Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif Classification TRANSCRIPTION Compound 14-3-3 protein gamma Source (6A5S) Sequence A:  VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEE RNLLSVAYKNVVGARRSSWRVISSIEQKTNEKKIEMVRAY REKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLK MKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHM QPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAI AELDTLNEDSYKDSTLIMQLLRDNLTLWTS B:  DREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEER NLLSVAYKNVVGARRSSWRVISSIEQKTNEKKIEMVRAYR EKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKM KGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ PTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIA ELDTLNEDSYKDSTLIMQLLRDNLTLWTS C:  VTSSXCPADLT D:  DREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEER NLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMV RAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVF YLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISK EHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS E:  VTSSXCPADLT F:  VTSSXCPADLT G:  DREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEER NLLSVAYKNVVGARRSSWRVISSIEQKTEKKIEMVRAYRE KIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMK GDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQP THPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAE LDTLNEDSYKDSTLIMQLLRDNLTLWTS H:  VTSSXCPADLT Description Functional site 1) chain A residue 120 type sequence K description binding site for residue NA A 301 source : AC1 2) chain B residue 202 type sequence D description binding site for residue MG B 301 source : AC2 3) chain B residue 203 type sequence D description binding site for residue MG B 301 source : AC2 4) chain B residue 204 type sequence A description binding site for residue MG B 301 source : AC2 5) chain B residue 205 type sequence I description binding site for residue MG B 301 source : AC2 6) chain B residue 206 type sequence A description binding site for residue MG B 301 source : AC2 7) chain B residue 50 type sequence K description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 8) chain B residue 57 type sequence R description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 9) chain B residue 132 type sequence R description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 10) chain B residue 133 type sequence Y description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 11) chain B residue 174 type sequence G description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 12) chain B residue 177 type sequence L description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 13) chain B residue 178 type sequence N description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 14) chain B residue 225 type sequence L description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 15) chain C residue 5 type sequence S description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 16) chain C residue 8 type sequence P description binding site for Ligand residues SEP C 6 through CYS C 7 bound to SER C 5 source : AC3 17) chain A residue 50 type sequence K description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 18) chain A residue 57 type sequence R description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 19) chain A residue 132 type sequence R description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 20) chain A residue 133 type sequence Y description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 21) chain A residue 174 type sequence G description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 22) chain A residue 177 type sequence L description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 23) chain A residue 178 type sequence N description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 24) chain A residue 225 type sequence L description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 25) chain E residue 5 type sequence S description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 26) chain E residue 8 type sequence P description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 27) chain E residue 9 type sequence A description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 28) chain D residue 50 type sequence K description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 29) chain D residue 57 type sequence R description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 30) chain D residue 132 type sequence R description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 31) chain D residue 133 type sequence Y description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 32) chain D residue 174 type sequence G description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 33) chain D residue 177 type sequence L description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 34) chain D residue 178 type sequence N description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 35) chain F residue 5 type sequence S description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 36) chain F residue 8 type sequence P description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 37) chain F residue 9 type sequence A description binding site for Ligand residues SEP F 6 through CYS F 7 bound to SER F 5 source : AC5 38) chain G residue 50 type sequence K description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 39) chain G residue 57 type sequence R description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 40) chain G residue 132 type sequence R description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 41) chain G residue 133 type sequence Y description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 42) chain G residue 174 type sequence G description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 43) chain G residue 177 type sequence L description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 44) chain G residue 178 type sequence N description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 45) chain H residue 5 type sequence S description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 46) chain H residue 8 type sequence P description binding site for Ligand residues SEP H 6 through CYS H 7 bound to SER H 5 source : AC6 47) chain A residue 42-52 type prosite sequence RNLLSVAYKNV description 1433_1 14-3-3 proteins signature 1. RNLLSVAYKNV source prosite : PS00796 48) chain A residue 216-235 type prosite sequence YKDSTLIMQLLRDNLTLWTS description 1433_2 14-3-3 proteins signature 2. YKDSTLIMQLLRDNLTLWTS source prosite : PS00797

Display surface Download Links