eF-site ID 6a5s-A PDB Code 6a5s Chain A click to enlarge Title Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif Classification TRANSCRIPTION Compound 14-3-3 protein gamma Source (6A5S) Sequence A:  VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEE RNLLSVAYKNVVGARRSSWRVISSIEQKTNEKKIEMVRAY REKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLK MKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHM QPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAI AELDTLNEDSYKDSTLIMQLLRDNLTLWTS Description Functional site 1) chain A residue 120 type sequence K description binding site for residue NA A 301 source : AC1 2) chain A residue 50 type sequence K description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 3) chain A residue 57 type sequence R description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 4) chain A residue 132 type sequence R description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 5) chain A residue 133 type sequence Y description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 6) chain A residue 174 type sequence G description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 7) chain A residue 177 type sequence L description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 8) chain A residue 178 type sequence N description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 9) chain A residue 225 type sequence L description binding site for Ligand residues SEP E 6 through CYS E 7 bound to SER E 5 source : AC4 10) chain A residue 42-52 type prosite sequence RNLLSVAYKNV description 1433_1 14-3-3 proteins signature 1. RNLLSVAYKNV source prosite : PS00796 11) chain A residue 216-235 type prosite sequence YKDSTLIMQLLRDNLTLWTS description 1433_2 14-3-3 proteins signature 2. YKDSTLIMQLLRDNLTLWTS source prosite : PS00797 12) chain A residue 57 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:17085597 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 132 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000269|PubMed:17085597 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 2 type MOD_RES sequence V description N-acetylvaline; partial => ECO:0000269|PubMed:14534293, ECO:0000269|Ref.7, ECO:0000269|Ref.9, ECO:0007744|PubMed:19413330 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 133 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P61983 source Swiss-Prot : SWS_FT_FI5 16) chain A residue 145 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|Ref.7 source Swiss-Prot : SWS_FT_FI6 17) chain A residue 215 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P61983 source Swiss-Prot : SWS_FT_FI7 18) chain A residue 234 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI8 19) chain A residue 235 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links