eF-site ID 6a5p-e PDB Code 6a5p Chain e click to enlarge Title RNA polymerase II elongation complex stalled at SHL(-5) of the nucleosome Classification TRANSCRIPTION/RNA/DNA Compound DNA-directed RNA polymerase subunit Source ORGANISM_COMMON: Yeast; ORGANISM_SCIENTIFIC: Komagataella phaffii (strain GS115 / ATCC 20864); Sequence e:  HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF KTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVT IMPKDIQLARRIRGERA Description Functional site 1) chain e residue 57 type MOD_RES sequence S description Phosphoserine => ECO:0000269|PubMed:20850016 source Swiss-Prot : SWS_FT_FI21 2) chain e residue 79 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435, ECO:0000269|PubMed:29211711 source Swiss-Prot : SWS_FT_FI22 3) chain e residue 80 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|PubMed:20850016 source Swiss-Prot : SWS_FT_FI23 4) chain e residue 86 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI24 5) chain e residue 107 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI25 6) chain e residue 115 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000269|PubMed:31542297 source Swiss-Prot : SWS_FT_FI26 7) chain e residue 122 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435, ECO:0000269|PubMed:27436229 source Swiss-Prot : SWS_FT_FI27 8) chain e residue 64 type MOD_RES sequence K description Dimethylated arginine => ECO:0000250|UniProtKB:Q96A08 source Swiss-Prot : SWS_FT_FI13

Display surface Download Links