eF-site ID 5zy6-A
PDB Code 5zy6
Chain A

click to enlarge
Title catechol methyltransferase spCOMT
Classification TRANSFERASE
Compound Probable catechol O-methyltransferase 1
Source (COMT1_SCHPO)
Sequence A:  EKEQLFLQHIQNLPQERLDAIRGHPELVLKEIDEFTYPDG
SGVRMCIGDVKGGFIVGKIRERKPKIMVELGGYLGYSAIL
FGNEISKIPGGRYYSLEVNEDYAKIAYELVKLAGLDEIVT
IMIGKACDSLVELQQKLLHQALDMVFIDHWKDLYVPDLRV
IESLNMIAPGTLLVADNIITPGAPEYHKYVNMSPEERRGY
QAKVRNVNGFDFIGRWDLIYKTETKEFDAVDVTECVGYAK
Description (1)  Probable catechol O-methyltransferase 1 (E.C.2.1.1.6)


Functional site

1) chain A
residue 54
type
ligand
sequence M
description binding site for residue SAM A 301
source : AC1

2) chain A
residue 56
type
ligand
sequence I
description binding site for residue SAM A 301
source : AC1

3) chain A
residue 80
type
ligand
sequence G
description binding site for residue SAM A 301
source : AC1

4) chain A
residue 81
type
ligand
sequence G
description binding site for residue SAM A 301
source : AC1

5) chain A
residue 82
type
ligand
sequence Y
description binding site for residue SAM A 301
source : AC1

6) chain A
residue 85
type
ligand
sequence Y
description binding site for residue SAM A 301
source : AC1

7) chain A
residue 86
type
ligand
sequence S
description binding site for residue SAM A 301
source : AC1

8) chain A
residue 105
type
ligand
sequence L
description binding site for residue SAM A 301
source : AC1

9) chain A
residue 106
type
ligand
sequence E
description binding site for residue SAM A 301
source : AC1

10) chain A
residue 107
type
ligand
sequence V
description binding site for residue SAM A 301
source : AC1

11) chain A
residue 111
type
ligand
sequence Y
description binding site for residue SAM A 301
source : AC1

12) chain A
residue 135
type
ligand
sequence A
description binding site for residue SAM A 301
source : AC1

13) chain A
residue 162
type
ligand
sequence D
description binding site for residue SAM A 301
source : AC1

14) chain A
residue 163
type
ligand
sequence H
description binding site for residue SAM A 301
source : AC1

15) chain A
residue 164
type
ligand
sequence W
description binding site for residue SAM A 301
source : AC1

16) chain A
residue 167
type
ligand
sequence L
description binding site for residue SAM A 301
source : AC1

17) chain A
residue 54-56
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence MCI
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301

18) chain A
residue 78-82
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence ELGGY
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301

19) chain A
residue 84-86
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence GYS
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301

20) chain A
residue 105-108
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence LEVN
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301

21) chain A
residue 111
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence Y
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301

22) chain A
residue 133-135
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence GKA
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301

23) chain A
residue 160
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence F
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301

24) chain A
residue 162-164
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence DHW
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301

25) chain A
residue 167
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence L
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301

26) chain A
residue 171
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence D
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_5zy6_A_301


Display surface

Download
Links