eF-site ID 5zxh-F
PDB Code 5zxh
Chain F

click to enlarge
Title The structure of MT189-tubulin complex
Classification STRUCTURAL PROTEIN
Compound Tubulin alpha-1B chain
Source (E1BQ43_CHICK)
Sequence F:  MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLM
LGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKL
IKTSPELSESCTWFPESYVIYPGNVWIAKSGILISSEAHV
IQKYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVL
RTSSEPYNSANFQDKTCHLTNHCIQKNYGRYEEGNEMFFE
EFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTK
HLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAE
LCQGIVDVAISSVFPLASIFIKLHHHHHH
Description (1)  Tubulin alpha-1B chain, Tubulin beta-2B chain, Stathmin-4, Tubulin tyrosine ligase


Functional site

1) chain F
residue 74
type
ligand
sequence K
description binding site for residue ACP F 401
source : AD7

2) chain F
residue 150
type
ligand
sequence K
description binding site for residue ACP F 401
source : AD7

3) chain F
residue 183
type
ligand
sequence Q
description binding site for residue ACP F 401
source : AD7

4) chain F
residue 184
type
ligand
sequence K
description binding site for residue ACP F 401
source : AD7

5) chain F
residue 186
type
ligand
sequence L
description binding site for residue ACP F 401
source : AD7

6) chain F
residue 198
type
ligand
sequence K
description binding site for residue ACP F 401
source : AD7

7) chain F
residue 200
type
ligand
sequence D
description binding site for residue ACP F 401
source : AD7

8) chain F
residue 202
type
ligand
sequence R
description binding site for residue ACP F 401
source : AD7

9) chain F
residue 222
type
ligand
sequence R
description binding site for residue ACP F 401
source : AD7

10) chain F
residue 241
type
ligand
sequence T
description binding site for residue ACP F 401
source : AD7

11) chain F
residue 242
type
ligand
sequence N
description binding site for residue ACP F 401
source : AD7

12) chain F
residue 318
type
ligand
sequence D
description binding site for residue ACP F 401
source : AD7

13) chain F
residue 320
type
ligand
sequence M
description binding site for residue ACP F 401
source : AD7

14) chain F
residue 330
type
ligand
sequence I
description binding site for residue ACP F 401
source : AD7

15) chain F
residue 331
type
ligand
sequence E
description binding site for residue ACP F 401
source : AD7

16) chain F
residue 333
type
ligand
sequence N
description binding site for residue ACP F 401
source : AD7


Display surface

Download
Links