eF-site ID 5zxh-E
PDB Code 5zxh
Chain E

click to enlarge
Title The structure of MT189-tubulin complex
Classification STRUCTURAL PROTEIN
Compound Tubulin alpha-1B chain
Source (E1BQ43_CHICK)
Sequence E:  MEVIELNKCTSGQSFEVILKPPDPSLEEIQKKLEAAEERR
KYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKL
AQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKE
Description (1)  Tubulin alpha-1B chain, Tubulin beta-2B chain, Stathmin-4, Tubulin tyrosine ligase

Display surface

Download
Links