eF-site ID 5zxh-D
PDB Code 5zxh
Chain D

click to enlarge
Title The structure of MT189-tubulin complex
Classification STRUCTURAL PROTEIN
Compound Tubulin alpha-1B chain
Source (E1BQ43_CHICK)
Sequence D:  MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDS
DLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGP
FGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYP
DRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETY
CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLLTVPELT
QQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQM
LNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGN
STAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTE
AESNMNDLVSEYQQYQDATAD
Description (1)  Tubulin alpha-1B chain, Tubulin beta-2B chain, Stathmin-4, Tubulin tyrosine ligase


Functional site

1) chain D
residue 252
type
ligand
sequence K
description binding site for residue GTP C 501
source : AD1

2) chain D
residue 10
type
ligand
sequence G
description binding site for residue GTP D 501
source : AD4

3) chain D
residue 11
type
ligand
sequence Q
description binding site for residue GTP D 501
source : AD4

4) chain D
residue 12
type
ligand
sequence C
description binding site for residue GTP D 501
source : AD4

5) chain D
residue 97
type
ligand
sequence A
description binding site for residue GTP D 501
source : AD4

6) chain D
residue 98
type
ligand
sequence G
description binding site for residue GTP D 501
source : AD4

7) chain D
residue 99
type
ligand
sequence N
description binding site for residue GTP D 501
source : AD4

8) chain D
residue 138
type
ligand
sequence S
description binding site for residue GTP D 501
source : AD4

9) chain D
residue 141
type
ligand
sequence G
description binding site for residue GTP D 501
source : AD4

10) chain D
residue 142
type
ligand
sequence G
description binding site for residue GTP D 501
source : AD4

11) chain D
residue 143
type
ligand
sequence T
description binding site for residue GTP D 501
source : AD4

12) chain D
residue 144
type
ligand
sequence G
description binding site for residue GTP D 501
source : AD4

13) chain D
residue 175
type
ligand
sequence V
description binding site for residue GTP D 501
source : AD4

14) chain D
residue 176
type
ligand
sequence S
description binding site for residue GTP D 501
source : AD4

15) chain D
residue 181
type
ligand
sequence E
description binding site for residue GTP D 501
source : AD4

16) chain D
residue 204
type
ligand
sequence N
description binding site for residue GTP D 501
source : AD4

17) chain D
residue 222
type
ligand
sequence Y
description binding site for residue GTP D 501
source : AD4

18) chain D
residue 226
type
ligand
sequence N
description binding site for residue GTP D 501
source : AD4

19) chain D
residue 236
type
ligand
sequence V
description binding site for residue 9LX D 503
source : AD6

20) chain D
residue 239
type
ligand
sequence C
description binding site for residue 9LX D 503
source : AD6

21) chain D
residue 240
type
ligand
sequence L
description binding site for residue 9LX D 503
source : AD6

22) chain D
residue 246
type
ligand
sequence L
description binding site for residue 9LX D 503
source : AD6

23) chain D
residue 249
type
ligand
sequence D
description binding site for residue 9LX D 503
source : AD6

24) chain D
residue 252
type
ligand
sequence K
description binding site for residue 9LX D 503
source : AD6

25) chain D
residue 253
type
ligand
sequence L
description binding site for residue 9LX D 503
source : AD6

26) chain D
residue 256
type
ligand
sequence N
description binding site for residue 9LX D 503
source : AD6

27) chain D
residue 313
type
ligand
sequence V
description binding site for residue 9LX D 503
source : AD6

28) chain D
residue 316
type
ligand
sequence V
description binding site for residue 9LX D 503
source : AD6

29) chain D
residue 350
type
ligand
sequence K
description binding site for residue 9LX D 503
source : AD6

30) chain D
residue 351
type
ligand
sequence T
description binding site for residue 9LX D 503
source : AD6

31) chain D
residue 352
type
ligand
sequence A
description binding site for residue 9LX D 503
source : AD6

32) chain D
residue 252
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence K
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_C_501

33) chain D
residue 200
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence Y
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

34) chain D
residue 236
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence V
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

35) chain D
residue 239-240
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence CL
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

36) chain D
residue 246
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence L
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

37) chain D
residue 248-250
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence ADL
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

38) chain D
residue 252-253
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence KL
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

39) chain D
residue 256-257
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence NM
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

40) chain D
residue 312-316
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence TVAAV
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

41) chain D
residue 347-352
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence NNVKTA
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

42) chain D
residue 368
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence I
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_D_503

43) chain D
residue 10-13
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence GQCG
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

44) chain D
residue 15-16
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence QI
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

45) chain D
residue 67
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence D
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

46) chain D
residue 96-100
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence GAGNN
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

47) chain D
residue 138
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence S
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

48) chain D
residue 140-145
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence GGGTGS
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

49) chain D
residue 169
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence V
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

50) chain D
residue 171-172
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence PS
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

51) chain D
residue 175-176
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence VS
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

52) chain D
residue 181
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence E
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

53) chain D
residue 204
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence N
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

54) chain D
residue 207
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence L
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

55) chain D
residue 222
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence Y
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

56) chain D
residue 225-226
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence LN
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501

57) chain D
residue 229
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence V
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_D_501


Display surface

Download
Links