eF-site ID 5zxh-B
PDB Code 5zxh
Chain B

click to enlarge
Title The structure of MT189-tubulin complex
Classification STRUCTURAL PROTEIN
Compound Tubulin alpha-1B chain
Source (E1BQ43_CHICK)
Sequence B:  MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDS
DLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGP
FGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYP
DRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETY
CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRAL
TVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMK
EVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMS
ATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMD
EMEFTEAESNMNDLVSEYQQYQDA
Description (1)  Tubulin alpha-1B chain, Tubulin beta-2B chain, Stathmin-4, Tubulin tyrosine ligase


Functional site

1) chain B
residue 252
type
ligand
sequence K
description binding site for residue GTP A 501
source : AC1

2) chain B
residue 10
type
ligand
sequence G
description binding site for residue GDP B 501
source : AC4

3) chain B
residue 11
type
ligand
sequence Q
description binding site for residue GDP B 501
source : AC4

4) chain B
residue 12
type
ligand
sequence C
description binding site for residue GDP B 501
source : AC4

5) chain B
residue 15
type
ligand
sequence Q
description binding site for residue GDP B 501
source : AC4

6) chain B
residue 138
type
ligand
sequence S
description binding site for residue GDP B 501
source : AC4

7) chain B
residue 141
type
ligand
sequence G
description binding site for residue GDP B 501
source : AC4

8) chain B
residue 142
type
ligand
sequence G
description binding site for residue GDP B 501
source : AC4

9) chain B
residue 143
type
ligand
sequence T
description binding site for residue GDP B 501
source : AC4

10) chain B
residue 144
type
ligand
sequence G
description binding site for residue GDP B 501
source : AC4

11) chain B
residue 171
type
ligand
sequence P
description binding site for residue GDP B 501
source : AC4

12) chain B
residue 175
type
ligand
sequence V
description binding site for residue GDP B 501
source : AC4

13) chain B
residue 177
type
ligand
sequence D
description binding site for residue GDP B 501
source : AC4

14) chain B
residue 181
type
ligand
sequence E
description binding site for residue GDP B 501
source : AC4

15) chain B
residue 204
type
ligand
sequence N
description binding site for residue GDP B 501
source : AC4

16) chain B
residue 222
type
ligand
sequence Y
description binding site for residue GDP B 501
source : AC4

17) chain B
residue 226
type
ligand
sequence N
description binding site for residue GDP B 501
source : AC4

18) chain B
residue 11
type
ligand
sequence Q
description binding site for residue MG B 502
source : AC5

19) chain B
residue 177
type
ligand
sequence D
description binding site for residue MG B 502
source : AC5

20) chain B
residue 156
type
ligand
sequence R
description binding site for residue MES B 503
source : AC6

21) chain B
residue 160
type
ligand
sequence P
description binding site for residue MES B 503
source : AC6

22) chain B
residue 161
type
ligand
sequence D
description binding site for residue MES B 503
source : AC6

23) chain B
residue 162
type
ligand
sequence R
description binding site for residue MES B 503
source : AC6

24) chain B
residue 195
type
ligand
sequence N
description binding site for residue MES B 503
source : AC6

25) chain B
residue 197
type
ligand
sequence D
description binding site for residue MES B 503
source : AC6

26) chain B
residue 251
type
ligand
sequence R
description binding site for residue MES B 503
source : AC6

27) chain B
residue 111
type
ligand
sequence E
description binding site for residue CA B 504
source : AC7

28) chain B
residue 294
type
ligand
sequence F
description binding site for residue MES B 505
source : AC8

29) chain B
residue 295
type
ligand
sequence D
description binding site for residue MES B 505
source : AC8

30) chain B
residue 296
type
ligand
sequence S
description binding site for residue MES B 505
source : AC8

31) chain B
residue 305
type
ligand
sequence P
description binding site for residue MES B 505
source : AC8

32) chain B
residue 306
type
ligand
sequence R
description binding site for residue MES B 505
source : AC8

33) chain B
residue 310
type
ligand
sequence Y
description binding site for residue MES B 505
source : AC8

34) chain B
residue 337
type
ligand
sequence N
description binding site for residue MES B 505
source : AC8

35) chain B
residue 236
type
ligand
sequence V
description binding site for residue 9LX B 506
source : AC9

36) chain B
residue 239
type
ligand
sequence C
description binding site for residue 9LX B 506
source : AC9

37) chain B
residue 246
type
ligand
sequence L
description binding site for residue 9LX B 506
source : AC9

38) chain B
residue 249
type
ligand
sequence D
description binding site for residue 9LX B 506
source : AC9

39) chain B
residue 253
type
ligand
sequence L
description binding site for residue 9LX B 506
source : AC9

40) chain B
residue 256
type
ligand
sequence N
description binding site for residue 9LX B 506
source : AC9

41) chain B
residue 257
type
ligand
sequence M
description binding site for residue 9LX B 506
source : AC9

42) chain B
residue 313
type
ligand
sequence V
description binding site for residue 9LX B 506
source : AC9

43) chain B
residue 314
type
ligand
sequence A
description binding site for residue 9LX B 506
source : AC9

44) chain B
residue 316
type
ligand
sequence V
description binding site for residue 9LX B 506
source : AC9

45) chain B
residue 348
type
ligand
sequence N
description binding site for residue 9LX B 506
source : AC9

46) chain B
residue 350
type
ligand
sequence K
description binding site for residue 9LX B 506
source : AC9

47) chain B
residue 351
type
ligand
sequence T
description binding site for residue 9LX B 506
source : AC9

48) chain B
residue 352
type
ligand
sequence A
description binding site for residue 9LX B 506
source : AC9

49) chain B
residue 252
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence K
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_5zxh_A_501

50) chain B
residue 200
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence Y
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

51) chain B
residue 235-237
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence GVT
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

52) chain B
residue 239-240
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence CL
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

53) chain B
residue 246
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence L
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

54) chain B
residue 248-250
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence ADL
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

55) chain B
residue 252-253
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence KL
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

56) chain B
residue 256-257
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence NM
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

57) chain B
residue 312-316
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence TVAAV
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

58) chain B
residue 348
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence N
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

59) chain B
residue 350-352
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence KTA
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

60) chain B
residue 368
type binding
ligand 9LX: 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol
sequence I
description 2-(6-fluoro-3-{[(4-methoxyphenyl)methyl]amino}imidazo[1,2-a]pyridin-2-yl)phenol binding site
source pdb_hetatom : 9LX_5zxh_B_506

61) chain B
residue 156
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence R
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_503

62) chain B
residue 160-164
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence PDRIM
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_503

63) chain B
residue 194-197
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence ENTD
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_503

64) chain B
residue 251
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence R
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_503

65) chain B
residue 9-13
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence AGQCG
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

66) chain B
residue 15-16
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence QI
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

67) chain B
residue 67
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence D
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

68) chain B
residue 97
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence A
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

69) chain B
residue 99
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence N
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

70) chain B
residue 138
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence S
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

71) chain B
residue 140-145
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence GGGTGS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

72) chain B
residue 169
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence V
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

73) chain B
residue 171-172
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence PS
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

74) chain B
residue 175-177
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence VSD
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

75) chain B
residue 181
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence E
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

76) chain B
residue 204
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence N
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

77) chain B
residue 207
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence L
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

78) chain B
residue 222
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence Y
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

79) chain B
residue 225-226
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence LN
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

80) chain B
residue 229
type binding
ligand GDP: GUANOSINE-5'-DIPHOSPHATE
sequence V
description GUANOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : GDP_5zxh_B_501

81) chain B
residue 294-296
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence FDS
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_505

82) chain B
residue 304-306
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence DPR
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_505

83) chain B
residue 310
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence Y
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_505

84) chain B
residue 333
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence V
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_505

85) chain B
residue 337
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence N
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_505

86) chain B
residue 340-341
type binding
ligand MES: 2-(N-MORPHOLINO)-ETHANESULFONIC ACID
sequence YF
description 2-(N-MORPHOLINO)-ETHANESULFONIC ACID binding site
source pdb_hetatom : MES_5zxh_B_505


Display surface

Download
Links