eF-site ID 5zwy-B
PDB Code 5zwy
Chain B

click to enlarge
Title Ribokinase from Leishmania donovani
Classification TRANSFERASE
Compound Ribokinase
Source (E9BIX7_LEIDB)
Sequence B:  RARNVRSHTGEYAPDILVVGSCFLDYVGYVDHMPQVGETM
HSVSFHKGFGGKGANQAVAAGRLGAKVAMVSMVGTDGDGS
DYIKELERNGVDTAYMFRTGKSSTGLAMILVDTKSSNNEI
VICPNATNHFTPELLRAQTNNYERILHTGLKYLICQNEIP
LPTTLDTIKEAHSRGVYTVFNSAPAPKPAEVEQIKPFLPY
VSLFCPNEVEATLITGVKDTESAFSAIKALQQLGVRDVVI
TLGAAGFVLSENGAEPVHVTGKHVKAVDTTGAGDCFVGSM
VYFMSRGRNLLEACKRANECAAISVTRKGTQLSYPHPSEL
PAGVM
Description (1)  Ribokinase (E.C.2.7.1.15)


Functional site

1) chain B
residue 29
type
ligand
sequence V
description binding site for residue GOL B 401
source : AC9

2) chain B
residue 48
type
ligand
sequence H
description binding site for residue GOL B 401
source : AC9

3) chain B
residue 272
type
ligand
sequence D
description binding site for residue GOL B 401
source : AC9

4) chain B
residue 312
type
ligand
sequence K
description binding site for residue GOL B 401
source : AC9

5) chain B
residue 313
type
ligand
sequence G
description binding site for residue GOL B 401
source : AC9

6) chain B
residue 314
type
ligand
sequence T
description binding site for residue GOL B 401
source : AC9

7) chain B
residue 27
type
ligand
sequence D
description binding site for residue GOL B 402
source : AD1

8) chain B
residue 52
type
ligand
sequence G
description binding site for residue GOL B 402
source : AD1

9) chain B
residue 53
type
ligand
sequence G
description binding site for residue GOL B 402
source : AD1

10) chain B
residue 54
type
ligand
sequence K
description binding site for residue GOL B 402
source : AD1

11) chain B
residue 57
type
ligand
sequence N
description binding site for residue GOL B 402
source : AD1

12) chain B
residue 109
type
ligand
sequence A
description binding site for residue GOL B 402
source : AD1

13) chain B
residue 272
type
ligand
sequence D
description binding site for residue NA B 403
source : AD2

14) chain B
residue 308
type
ligand
sequence S
description binding site for residue NA B 403
source : AD2

15) chain B
residue 311
type
ligand
sequence R
description binding site for residue NA B 403
source : AD2

16) chain B
residue 317
type
ligand
sequence S
description binding site for residue NA B 403
source : AD2

17) chain B
residue 162
type
ligand
sequence P
description binding site for residue NA B 404
source : AD3

18) chain B
residue 67
type
ligand
sequence A
description binding site for residue NA B 405
source : AD4

19) chain B
residue 92
type
ligand
sequence G
description binding site for residue NA B 405
source : AD4

20) chain B
residue 135
type
ligand
sequence E
description binding site for residue NA B 405
source : AD4

21) chain B
residue 64
type
ligand
sequence R
description binding site for residue CL B 406
source : AD5

22) chain B
residue 320
type
ligand
sequence H
description binding site for residue CL B 406
source : AD5

23) chain B
residue 4
type
ligand
sequence A
description binding site for residue CL B 407
source : AD6

24) chain B
residue 5
type
ligand
sequence R
description binding site for residue CL B 407
source : AD6

25) chain B
residue 100
type
ligand
sequence R
description binding site for residue CL B 407
source : AD6

26) chain B
residue 51
type
ligand
sequence F
description binding site for residue CL B 408
source : AD7

27) chain B
residue 104
type
ligand
sequence S
description binding site for residue CL B 409
source : AD8

28) chain B
residue 105
type
ligand
sequence S
description binding site for residue CL B 409
source : AD8

29) chain B
residue 127
type
ligand
sequence N
description binding site for residue CL B 409
source : AD8

30) chain B
residue 25
type binding
ligand GOL: GLYCEROL
sequence F
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

31) chain B
residue 27
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

32) chain B
residue 52-54
type binding
ligand GOL: GLYCEROL
sequence GGK
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

33) chain B
residue 57
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

34) chain B
residue 109
type binding
ligand GOL: GLYCEROL
sequence A
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

35) chain B
residue 111
type binding
ligand GOL: GLYCEROL
sequence I
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

36) chain B
residue 160
type binding
ligand GOL: GLYCEROL
sequence E
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

37) chain B
residue 274-275
type binding
ligand GOL: GLYCEROL
sequence TG
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

38) chain B
residue 278
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

39) chain B
residue 314
type binding
ligand GOL: GLYCEROL
sequence T
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_402

40) chain B
residue 27
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_401

41) chain B
residue 29
type binding
ligand GOL: GLYCEROL
sequence V
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_401

42) chain B
residue 31
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_401

43) chain B
residue 48
type binding
ligand GOL: GLYCEROL
sequence H
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_401

44) chain B
residue 50
type binding
ligand GOL: GLYCEROL
sequence G
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_401

45) chain B
residue 272
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_401

46) chain B
residue 274
type binding
ligand GOL: GLYCEROL
sequence T
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_401

47) chain B
residue 312-314
type binding
ligand GOL: GLYCEROL
sequence KGT
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_B_401


Display surface

Download
Links