eF-site ID 5zwy-A
PDB Code 5zwy
Chain A

click to enlarge
Title Ribokinase from Leishmania donovani
Classification TRANSFERASE
Compound Ribokinase
Source (E9BIX7_LEIDB)
Sequence A:  RARNVRSHTGEYAPDILVVGSCFLDYVGYVDHMPQVGETM
HSVSFHKGFGGKGANQAVAAGRLGAKVAMVSMVGTDGDGS
DYIKELERNGVDTAYMFRTGKSSTGLAMILVDTKSSNNEI
VICPNATNHFTPELLRAQTNNYERILHTGLKYLICQNEIP
LPTTLDTIKEAHSRGVYTVFNSAPAPKPAEVEQIKPFLPY
VSLFCPNEVEATLITGVKVTDTESAFSAIKALQQLGVRDV
VITLGAAGFVLSENGAEPVHVTGTTGAGDCFVGSMVYFMS
RGRNLLEACKRANECAAISVTRKGTQL
Description (1)  Ribokinase (E.C.2.7.1.15)


Functional site

1) chain A
residue 27
type
ligand
sequence D
description binding site for residue GOL A 401
source : AC1

2) chain A
residue 52
type
ligand
sequence G
description binding site for residue GOL A 401
source : AC1

3) chain A
residue 53
type
ligand
sequence G
description binding site for residue GOL A 401
source : AC1

4) chain A
residue 54
type
ligand
sequence K
description binding site for residue GOL A 401
source : AC1

5) chain A
residue 57
type
ligand
sequence N
description binding site for residue GOL A 401
source : AC1

6) chain A
residue 162
type
ligand
sequence P
description binding site for residue NA A 402
source : AC2

7) chain A
residue 67
type
ligand
sequence A
description binding site for residue NA A 403
source : AC3

8) chain A
residue 92
type
ligand
sequence G
description binding site for residue NA A 403
source : AC3

9) chain A
residue 135
type
ligand
sequence E
description binding site for residue NA A 403
source : AC3

10) chain A
residue 5
type
ligand
sequence R
description binding site for residue NA A 404
source : AC4

11) chain A
residue 100
type
ligand
sequence R
description binding site for residue NA A 404
source : AC4

12) chain A
residue 90
type
ligand
sequence R
description binding site for residue NA A 405
source : AC5

13) chain A
residue 131
type
ligand
sequence H
description binding site for residue NA A 405
source : AC5

14) chain A
residue 4
type
ligand
sequence A
description binding site for residue CL A 406
source : AC6

15) chain A
residue 5
type
ligand
sequence R
description binding site for residue CL A 406
source : AC6

16) chain A
residue 100
type
ligand
sequence R
description binding site for residue CL A 406
source : AC6

17) chain A
residue 105
type
ligand
sequence S
description binding site for residue CL A 407
source : AC7

18) chain A
residue 127
type
ligand
sequence N
description binding site for residue CL A 407
source : AC7

19) chain A
residue 51
type
ligand
sequence F
description binding site for residue CL A 408
source : AC8

20) chain A
residue 25
type binding
ligand GOL: GLYCEROL
sequence F
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_A_401

21) chain A
residue 27
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_A_401

22) chain A
residue 51-54
type binding
ligand GOL: GLYCEROL
sequence FGGK
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_A_401

23) chain A
residue 57
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_A_401

24) chain A
residue 109
type binding
ligand GOL: GLYCEROL
sequence A
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_A_401

25) chain A
residue 111
type binding
ligand GOL: GLYCEROL
sequence I
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_A_401

26) chain A
residue 160
type binding
ligand GOL: GLYCEROL
sequence E
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_A_401

27) chain A
residue 274-275
type binding
ligand GOL: GLYCEROL
sequence TG
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_A_401

28) chain A
residue 278
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_5zwy_A_401


Display surface

Download
Links