eF-site ID 5zo1-A
PDB Code 5zo1
Chain A

click to enlarge
Title Crystal structure of mouse nectin-like molecule 4 (mNecl-4) full ectodomain (Ig1-Ig3), 2.2A
Classification CELL ADHESION
Compound Cell adhesion molecule 4
Source (CADM4_MOUSE)
Sequence A:  TEQVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNG
TRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYT
EDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLVP
RSRPAAVLRWYRDRKELKGVSSGQENGKVWSVASTVRFRV
DRKDDGGIVICEAQNQALPSGHSKQTQYVLDVQYSPTARI
HASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGQESLPER
AEAVGETLTLPGLVSADQGTYTCEAANKHGHARALYVLVV
YDPGAVVE
Description (1)  Cell adhesion molecule 4


Functional site

1) chain A
residue 260
type
ligand
sequence R
description binding site for residue GOL A 404
source : AC1

2) chain A
residue 290
type
ligand
sequence T
description binding site for residue GOL A 404
source : AC1

3) chain A
residue 299
type
ligand
sequence H
description binding site for residue GOL A 404
source : AC1

4) chain A
residue 130
type
ligand
sequence E
description binding site for residue GOL A 405
source : AC2

5) chain A
residue 131
type
ligand
sequence V
description binding site for residue GOL A 405
source : AC2

6) chain A
residue 132
type
ligand
sequence R
description binding site for residue GOL A 405
source : AC2

7) chain A
residue 142
type
ligand
sequence E
description binding site for residue GOL A 405
source : AC2

8) chain A
residue 143
type
ligand
sequence L
description binding site for residue GOL A 405
source : AC2

9) chain A
residue 144
type
ligand
sequence S
description binding site for residue GOL A 405
source : AC2

10) chain A
residue 286
type
ligand
sequence Q
description binding site for residue GOL A 405
source : AC2

11) chain A
residue 307
type
ligand
sequence V
description binding site for residue GOL A 405
source : AC2

12) chain A
residue 49
type
ligand
sequence Y
description binding site for Poly-Saccharide residues FUC A 401 through NAG A 403 bound to ASN A 67
source : AC3

13) chain A
residue 51
type
ligand
sequence G
description binding site for Poly-Saccharide residues FUC A 401 through NAG A 403 bound to ASN A 67
source : AC3

14) chain A
residue 53
type
ligand
sequence I
description binding site for Poly-Saccharide residues FUC A 401 through NAG A 403 bound to ASN A 67
source : AC3

15) chain A
residue 67
type
ligand
sequence N
description binding site for Poly-Saccharide residues FUC A 401 through NAG A 403 bound to ASN A 67
source : AC3

16) chain A
residue 82
type
ligand
sequence F
description binding site for Poly-Saccharide residues FUC A 401 through NAG A 403 bound to ASN A 67
source : AC3

17) chain A
residue 83
type
ligand
sequence S
description binding site for Poly-Saccharide residues FUC A 401 through NAG A 403 bound to ASN A 67
source : AC3

18) chain A
residue 84
type
ligand
sequence P
description binding site for Poly-Saccharide residues FUC A 401 through NAG A 403 bound to ASN A 67
source : AC3

19) chain A
residue 49
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Y
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_5zo1_A_403

20) chain A
residue 51
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence G
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_5zo1_A_403

21) chain A
residue 82-84
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence FSP
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_5zo1_A_403

22) chain A
residue 49
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Y
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_5zo1_A_402

23) chain A
residue 51-53
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence GSI
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_5zo1_A_402

24) chain A
residue 67-68
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NG
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_5zo1_A_402

25) chain A
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_5zo1_A_402

26) chain A
residue 67-68
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence NG
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_5zo1_A_401

27) chain A
residue 79
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence L
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_5zo1_A_401

28) chain A
residue 82
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence F
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_5zo1_A_401

29) chain A
residue 259-262
type binding
ligand GOL: GLYCEROL
sequence NRGQ
description GLYCEROL binding site
source pdb_hetatom : GOL_5zo1_A_404

30) chain A
residue 288-290
type binding
ligand GOL: GLYCEROL
sequence TYT
description GLYCEROL binding site
source pdb_hetatom : GOL_5zo1_A_404

31) chain A
residue 301
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_5zo1_A_404

32) chain A
residue 303
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_5zo1_A_404

33) chain A
residue 283
type binding
ligand GOL: GLYCEROL
sequence S
description GLYCEROL binding site
source pdb_hetatom : GOL_5zo1_A_405

34) chain A
residue 286-287
type binding
ligand GOL: GLYCEROL
sequence QG
description GLYCEROL binding site
source pdb_hetatom : GOL_5zo1_A_405

35) chain A
residue 306-308
type binding
ligand GOL: GLYCEROL
sequence LVV
description GLYCEROL binding site
source pdb_hetatom : GOL_5zo1_A_405


Display surface

Download
Links