eF-site ID 5zni-A
PDB Code 5zni
Chain A

click to enlarge
Title Plasmodium falciparum purine nucleoside phosphorylase in complex with mefloquine
Classification TRANSFERASE
Compound Purine nucleoside phosphorylase
Source (Q8T9Z7_PLAFA)
Sequence A:  NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLA
YNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNG
AKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLI
HGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYP
NKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGI
LIVDGCPFKHQLENMIKIALGACAKLATKYA
Description (1)  Purine nucleoside phosphorylase (E.C.2.4.2.1)


Functional site

1) chain A
residue 23
type
ligand
sequence G
description binding site for residue PO4 A 301
source : AC1

2) chain A
residue 27
type
ligand
sequence R
description binding site for residue PO4 A 301
source : AC1

3) chain A
residue 45
type
ligand
sequence R
description binding site for residue PO4 A 301
source : AC1

4) chain A
residue 88
type
ligand
sequence R
description binding site for residue PO4 A 301
source : AC1

5) chain A
residue 90
type
ligand
sequence G
description binding site for residue PO4 A 301
source : AC1

6) chain A
residue 91
type
ligand
sequence S
description binding site for residue PO4 A 301
source : AC1

7) chain A
residue 7
type
ligand
sequence H
description binding site for residue YMZ A 302
source : AC2

8) chain A
residue 45
type
ligand
sequence R
description binding site for residue YMZ A 302
source : AC2

9) chain A
residue 92
type
ligand
sequence C
description binding site for residue YMZ A 302
source : AC2

10) chain A
residue 93
type
ligand
sequence G
description binding site for residue YMZ A 302
source : AC2

11) chain A
residue 160
type
ligand
sequence Y
description binding site for residue YMZ A 302
source : AC2

12) chain A
residue 181
type
ligand
sequence V
description binding site for residue YMZ A 302
source : AC2

13) chain A
residue 182
type
ligand
sequence E
description binding site for residue YMZ A 302
source : AC2

14) chain A
residue 183
type
ligand
sequence M
description binding site for residue YMZ A 302
source : AC2

15) chain A
residue 206
type
ligand
sequence D
description binding site for residue YMZ A 302
source : AC2

16) chain A
residue 207
type
ligand
sequence G
description binding site for residue YMZ A 302
source : AC2

17) chain A
residue 208
type
ligand
sequence C
description binding site for residue YMZ A 302
source : AC2

18) chain A
residue 209
type
ligand
sequence P
description binding site for residue YMZ A 302
source : AC2

19) chain A
residue 66
type binding
ligand YMZ: Mefloquine
sequence V
description Mefloquine binding site
source pdb_hetatom : YMZ_5zni_A_302

20) chain A
residue 91-94
type binding
ligand YMZ: Mefloquine
sequence SCGS
description Mefloquine binding site
source pdb_hetatom : YMZ_5zni_A_302

21) chain A
residue 157
type binding
ligand YMZ: Mefloquine
sequence S
description Mefloquine binding site
source pdb_hetatom : YMZ_5zni_A_302

22) chain A
residue 159-160
type binding
ligand YMZ: Mefloquine
sequence MY
description Mefloquine binding site
source pdb_hetatom : YMZ_5zni_A_302

23) chain A
residue 170
type binding
ligand YMZ: Mefloquine
sequence L
description Mefloquine binding site
source pdb_hetatom : YMZ_5zni_A_302

24) chain A
residue 181-184
type binding
ligand YMZ: Mefloquine
sequence VEME
description Mefloquine binding site
source pdb_hetatom : YMZ_5zni_A_302

25) chain A
residue 206-209
type binding
ligand YMZ: Mefloquine
sequence DGCP
description Mefloquine binding site
source pdb_hetatom : YMZ_5zni_A_302


Display surface

Download
Links