eF-site ID 5zjz-A PDB Code 5zjz Chain A click to enlarge Title Stapled-peptides tailored against initiation of translation Classification RNA BINDING PROTEIN Compound Eukaryotic translation initiation factor 4E Source (5ZJZ) Sequence A:  EHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVED FWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGG RWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCG AVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPP KIVIGYQSHADTATKTKNRFVV Description Functional site 1) chain A residue 54 type sequence K description binding site for residue MGT A 301 source : AC1 2) chain A residue 55 type sequence T description binding site for residue MGT A 301 source : AC1 3) chain A residue 56 type sequence W description binding site for residue MGT A 301 source : AC1 4) chain A residue 101 type sequence M description binding site for residue MGT A 301 source : AC1 5) chain A residue 102 type sequence W description binding site for residue MGT A 301 source : AC1 6) chain A residue 103 type sequence E description binding site for residue MGT A 301 source : AC1 7) chain A residue 157 type sequence R description binding site for residue MGT A 301 source : AC1 8) chain A residue 162 type sequence K description binding site for residue MGT A 301 source : AC1 9) chain A residue 178 type sequence H description binding site for residues MK8 B 8 and MK8 B 12 source : AC2 10) chain A residue 181 type sequence R description binding site for residues MK8 B 8 and MK8 B 12 source : AC2 11) chain A residue 182 type sequence V description binding site for residues MK8 B 8 and MK8 B 12 source : AC2 12) chain A residue 90-113 type prosite sequence DYSLFKDGIEPMWEDEKNKRGGRW description IF4E Eukaryotic initiation factor 4E signature. DYslFKdgIePmWEDeknkrGGRW source prosite : PS00813 13) chain A residue 56 type BINDING sequence W description BINDING => ECO:0000269|PubMed:11879179, ECO:0000269|PubMed:12975586, ECO:0000269|PubMed:16271312 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 102 type BINDING sequence W description BINDING => ECO:0000269|PubMed:11879179, ECO:0000269|PubMed:12975586, ECO:0000269|PubMed:16271312 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 157 type BINDING sequence R description BINDING => ECO:0000269|PubMed:11879179, ECO:0000269|PubMed:12975586, ECO:0000269|PubMed:16271312 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 205 type BINDING sequence T description BINDING => ECO:0000269|PubMed:11879179, ECO:0000269|PubMed:12975586, ECO:0000269|PubMed:16271312 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 159 type SITE sequence K description (Microbial infection) Interaction with potato virus Y VPg => ECO:0000269|PubMed:31712417 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links