eF-site ID 5zjg-B
PDB Code 5zjg
Chain B

click to enlarge
Title Gamma-glutamyltranspeptidase from Pseudomonas nitroreducens complexed with Gly-Gly
Classification TRANSFERASE
Compound Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 L-subunit
Source (A0A239KXH0_9PSED)
Sequence B:  TTHFSIVDKDGNAVSNTYTLNWDFGSGVVVKGAGFLLNDE
MDDFSSKPGVANAFGVVGSDANAIEPGKRMLSSMSPSIVT
RDGHVSLVLGTPGGSRIFTSIFQVLNNVYDFHLPLEKAVA
AQRVHHQLLPKDTIYYDAYAPLTGKVADELKAMGYTLEDQ
GWNMGDIQAIRVNGKALETASDPRGRGVGMVVKP
Description (1)  Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 L-subunit (E.C. 2.3.2.2), Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 S-subunit


Functional site

1) chain B
residue 384
type
ligand
sequence N
description binding site for residue GLY B 701
source : AC1

2) chain B
residue 403
type
ligand
sequence E
description binding site for residue GLY B 701
source : AC1

3) chain B
residue 406
type
ligand
sequence D
description binding site for residue GLY B 701
source : AC1

4) chain B
residue 435
type
ligand
sequence S
description binding site for residue GLY B 701
source : AC1

5) chain B
residue 436
type
ligand
sequence S
description binding site for residue GLY B 701
source : AC1

6) chain B
residue 385
type
ligand
sequence W
description binding site for residue GLY B 702
source : AC2

7) chain B
residue 386
type
ligand
sequence D
description binding site for residue GLY B 702
source : AC2

8) chain B
residue 525
type
ligand
sequence W
description binding site for residue GLY B 702
source : AC2

9) chain B
residue 364
type
ligand
sequence T
description binding site for residue GLY B 703
source : AC3

10) chain B
residue 384
type
ligand
sequence N
description binding site for residue GLY B 703
source : AC3

11) chain B
residue 417
type
ligand
sequence F
description binding site for residue GLY B 703
source : AC3

12) chain B
residue 455
type
ligand
sequence P
description binding site for residue GLY B 703
source : AC3

13) chain B
residue 456
type
ligand
sequence G
description binding site for residue GLY B 703
source : AC3

14) chain B
residue 457
type
ligand
sequence G
description binding site for residue GLY B 703
source : AC3

15) chain B
residue 465
type
ligand
sequence F
description binding site for residue GOL B 704
source : AC4

16) chain B
residue 469
type
ligand
sequence N
description binding site for residue GOL B 704
source : AC4

17) chain B
residue 472
type
ligand
sequence Y
description binding site for residue GOL B 704
source : AC4

18) chain B
residue 473
type
ligand
sequence D
description binding site for residue GOL B 704
source : AC4

19) chain B
residue 364
type binding
ligand GLY: GLYCINE
sequence T
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

20) chain B
residue 382
type binding
ligand GLY: GLYCINE
sequence T
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

21) chain B
residue 384
type binding
ligand GLY: GLYCINE
sequence N
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

22) chain B
residue 403
type binding
ligand GLY: GLYCINE
sequence E
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

23) chain B
residue 406
type binding
ligand GLY: GLYCINE
sequence D
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

24) chain B
residue 417
type binding
ligand GLY: GLYCINE
sequence F
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

25) chain B
residue 435-437
type binding
ligand GLY: GLYCINE
sequence SSM
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

26) chain B
residue 457-458
type binding
ligand GLY: GLYCINE
sequence GS
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

27) chain B
residue 460
type binding
ligand GLY: GLYCINE
sequence I
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

28) chain B
residue 465
type binding
ligand GOL: GLYCEROL
sequence F
description GLYCEROL binding site
source pdb_hetatom : GOL_5zjg_B_704

29) chain B
residue 468-469
type binding
ligand GOL: GLYCEROL
sequence LN
description GLYCEROL binding site
source pdb_hetatom : GOL_5zjg_B_704

30) chain B
residue 472-473
type binding
ligand GOL: GLYCEROL
sequence YD
description GLYCEROL binding site
source pdb_hetatom : GOL_5zjg_B_704

31) chain B
residue 364
type binding
ligand GLY: GLYCINE
sequence T
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_702

32) chain B
residue 384-386
type binding
ligand GLY: GLYCINE
sequence NWD
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_702

33) chain B
residue 417
type binding
ligand GLY: GLYCINE
sequence F
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_702

34) chain B
residue 456
type binding
ligand GLY: GLYCINE
sequence G
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_702

35) chain B
residue 525
type binding
ligand GLY: GLYCINE
sequence W
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_702

36) chain B
residue 364
type binding
ligand GLY: GLYCINE
sequence T
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_703

37) chain B
residue 382
type binding
ligand GLY: GLYCINE
sequence T
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_703

38) chain B
residue 384-386
type binding
ligand GLY: GLYCINE
sequence NWD
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_703

39) chain B
residue 417
type binding
ligand GLY: GLYCINE
sequence F
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_703

40) chain B
residue 455-457
type binding
ligand GLY: GLYCINE
sequence PGG
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_703

41) chain B
residue 460
type binding
ligand GLY: GLYCINE
sequence I
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_703

42) chain B
residue 525
type binding
ligand GLY: GLYCINE
sequence W
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_703


Display surface

Download
Links