eF-site ID 5zjg-A
PDB Code 5zjg
Chain A

click to enlarge
Title Gamma-glutamyltranspeptidase from Pseudomonas nitroreducens complexed with Gly-Gly
Classification TRANSFERASE
Compound Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 L-subunit
Source (A0A239KXH0_9PSED)
Sequence A:  TLDGGAVAAPDQYGAKVAAEILKKGGNAVDAAVATAFTLA
VTYPEAGNIGGGGFMTLYVDGKPYFLDYREIAPKAATKTM
YLNEKGEVIENLSLVGAKAAGVPGTVMGLWEAHQRFGKLK
WSELLTPAIGYAQTGFKVADQQYQYRQDAIALFNGKTNFG
DYFGTMKPGEVFKQPELAKTLERIADKGPDDFYKGETAKL
LIAQMKQDGGLITSDDLVDYQAKWREPMRIDWQGNTLYTA
PLPSSGGIALAQLIGIKEQRAADFKGVELNSAKYIHLLSE
IEKRVFADRADYLGDPQFSKVPVAQLTDPKYIAKRAGEVN
PDAISATEKVRPGLEPHQ
Description (1)  Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 L-subunit (E.C. 2.3.2.2), Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 S-subunit


Functional site

1) chain A
residue 94
type
ligand
sequence R
description binding site for residue GLY B 701
source : AC1

2) chain A
residue 257
type
ligand
sequence W
description binding site for residue GOL B 704
source : AC4

3) chain A
residue 279
type
ligand
sequence I
description binding site for residue GOL B 704
source : AC4

4) chain A
residue 94
type binding
ligand GLY: GLYCINE
sequence R
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

5) chain A
residue 314
type binding
ligand GLY: GLYCINE
sequence R
description GLYCINE binding site
source pdb_hetatom : GLY_5zjg_B_701

6) chain A
residue 257-258
type binding
ligand GOL: GLYCEROL
sequence WQ
description GLYCEROL binding site
source pdb_hetatom : GOL_5zjg_B_704

7) chain A
residue 279
type binding
ligand GOL: GLYCEROL
sequence I
description GLYCEROL binding site
source pdb_hetatom : GOL_5zjg_B_704

8) chain A
residue 282-283
type binding
ligand GOL: GLYCEROL
sequence KE
description GLYCEROL binding site
source pdb_hetatom : GOL_5zjg_B_704


Display surface

Download
Links